TkA04G153800 | RubberDandelionOmics

Gene overview

TkA04G153800

Reference: TK1151 Chr: Chr04 Coordinates: 39745974-39750780 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2056 bp · TkA04G153800|TK1151|cDNA

ATACAAAGTTCATGGGTAAAGGTCGGCGAAGAACTCAACTCCTGAGTCATGTGAAATTATCGTCATCCACTGTTTAGTGGCGTCACTATTGCTACTTAATTAAACCCTAGACCAAACACATCCAACGCCTCATCTCTCTCTCCTTGATTTCATCAATGGCGAATCCCAGGAATGCAGCAGAGGGGCGACGACAAATGTTCGAATCATTCTATTCAGTCATTGCACTTGTATTCATATTAGTGGCCTGTGTGGAGCTCTGT...

CDS

Download CDS FASTA

1707 bp · TkA04G153800|TK1151|CDS

ATGGCGAATCCCAGGAATGCAGCAGAGGGGCGACGACAAATGTTCGAATCATTCTATTCAGTCATTGCACTTGTATTCATATTAGTGGCCTGTGTGGAGCTCTGTGATGCATCTACAGTCGTCGACGTTTACCGTCTTATTCAGTATGATATCTCCGGTGTTCCTTTCGGATCTCGTGTCGCATCGCTCAATCACCACGCTGGTTCTTCTCTCTTTGCTTCTGGTTCCGATCTCTCCCGCACTGTTGTCATACTTCCCCT...

Protein

Download Protein FASTA

568 aa · TkA04G153800|TK1151|PROTEIN

MANPRNAAEGRRQMFESFYSVIALVFILVACVELCDASTVVDVYRLIQYDISGVPFGSRVASLNHHAGSSLFASGSDLSRTVVILPLRELNETFIREYIEQGKPLGGLLLLLPRIFRLENSETVGGHGDSSDKENMKKLLEDLEQKLIHSSINYAVYFAYEDEDLDTVLADIKKNDAAGQPATATTGGYKLIVSSPTPKKLASPTITNIQGWLPGLKGDGDSNQLPTIAIVASYDTFGAAPGLSVGSDSNGSGVVGLLEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G153800`
TK1151 ID	TkA04G153800
OH-1004 ID	LXL04_033445
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G153800`
Location	Chr04:39745974-39750780 (+)
Description	Similar to Ncln: Nicalin
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033445` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009966 regulation of signal transduction Biological Process GO:0043254 regulation of protein-containing complex assembly Biological Process GO:0050821 protein stabilization Biological Process GO:0061635 regulation of protein complex stability Biological Process GO:0160063 multi-pass transmembrane protein insertion into ER membrane Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0032991 protein-containing complex Cellular Component GO:0160064 multi-pass translocon complex Cellular Component GO:0043022 ribosome binding Molecular Function
KEGG gene cross-reference	cfa:485062 dre:336844 hsa:56926 mmu:103425 rno:314648 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.548

Rank 1 · TkA04G153800 · TK1151

Golgi apparatus0.423

Rank 2 · TkA04G153800 · TK1151

Cytoplasm0.101

Rank 3 · TkA04G153800 · TK1151

Nucleus0.075

Rank 4 · TkA04G153800 · TK1151

Cell membrane0.058

Rank 5 · TkA04G153800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14343PrcB_C185-197 aa

PF05450Nicastrin227-354 aa

PF04389Peptidase_M28227-342 aa

PF14343PrcB_C308-341 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G153800	`PF14343`	PrcB_C	185	197	0.25	12.2
TkA04G153800	`PF05450`	Nicastrin	227	354	3.5e-08	34.0
TkA04G153800	`PF04389`	Peptidase_M28	227	342	2.3e-05	24.9
TkA04G153800	`PF14343`	PrcB_C	308	341	0.25	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card