TkA04G153050 | RubberDandelionOmics

Gene overview

TkA04G153050

Reference: TK1151 Chr: Chr04 Coordinates: 39536450-39541923 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1144 bp · TkA04G153050|TK1151|cDNA

CAGACAATGACTTGCGTTTTGGACCACCAACCCACCTACACGATTGACTCTAGAACACCGAGTCTACCGAGCTCAATACAAATCTAAAATAATCAAAAGGAATTTTATGTTGGTGGAGTGAAAGTGAAGCCGATGGATGTAATTTCTCAGTAATTGTTGGTGTTCTTGTCTGTTCCTTTTGATCTGTTCAACACGTATTTCCCTATAAAGAAACCTTCATCACAACCGATCAATTACACTCGTCCATTAATACCCTAAAT...

CDS

Download CDS FASTA

1428 bp · TkA04G153050|TK1151|CDS

ATGGAGGAAATTCAACGAAGAAAAGAAACAGAAGCTACATTCGCAAAACAAATTGAAGAAATCGAATCAATGAAGAACCAAAAACACCAATTCATGGAAGAGCTTCAAACCGTAAATAACCAAATACCGCAACTATTACACCAAATTTCAAACACCCGTGATACAGAAAAGGAGTTAGAGGAGAAGATCATTCAAGCTGTGAATCTGTTAATCAGTTTCAAAGAAAGCCGTGATAAGTTACAAGATGAGCAAGATAATGC...

Protein

Download Protein FASTA

475 aa · TkA04G153050|TK1151|PROTEIN

MEEIQRRKETEATFAKQIEEIESMKNQKHQFMEELQTVNNQIPQLLHQISNTRDTEKELEEKIIQAVNLLISFKESRDKLQDEQDNARRQINRLTKHDTDTITTTNLSQAQFYKPSFSEIMEATQDFNQSLKIGEGRYGSVYKGILRHVRVAIKMLPSLGSQSDAEFEHHAEVLSRTRHPNLVTLIGVCSATRSLIYEYLENGSLEDRIASSKGKTPSTLPWRTRIRIASEICSALIFLHANKPQIIHGNLTLANILLDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G153050`
TK1151 ID	TkA04G153050
OH-1004 ID	LXL04_022646
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	44.900
Protein coverage (%)	TK1151 98.737 / OH-1004 54.733 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G153050

Location Chr04:39536450-39541923 (+)

Description Similar to PUB33: U-box domain-containing protein 33

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45910`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At3g49060`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g61560`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0163000`	Functions as an E3 ubiquitin ligase.	MODD Mediates Deactivation and Degradation of OsbZIP46 to Negatively Regulate ABA Signaling and Drought Resistance in Rice.2016 · DOI: 10.1105/tpc.16.00171
`Os03g0424200`	Possesses E3 ubiquitin-protein ligase in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022646 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G45910

ath:AT3G49060

ath:AT5G61560

dosa:Os06g0163000

osa:4340220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.559

Rank 1 · TkA04G153050 · TK1151

Nucleus0.303

Rank 2 · TkA04G153050 · TK1151

Cell membrane0.284

Rank 3 · TkA04G153050 · TK1151

Golgi apparatus0.045

Rank 4 · TkA04G153050 · TK1151

Endoplasmic reticulum0.041

Rank 5 · TkA04G153050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10146zf-C4H22-117 aa

PF17675APG6_N2-95 aa

PF02403Seryl_tRNA_N3-52 aa

PF03961FapA3-83 aa

PF20379DUF66746-66 aa

PF08581Tup_N6-34 aa

PF05130FlgN7-97 aa

PF06818Fez18-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G153050	`PF10146`	zf-C4H2	2	117	0.0043	18.3
TkA04G153050	`PF17675`	APG6_N	2	95	2.1	9.5
TkA04G153050	`PF02403`	Seryl_tRNA_N	3	52	0.26	12.3
TkA04G153050	`PF03961`	FapA	3	83	5.8	7.1
TkA04G153050	`PF20379`	DUF6674	6	66	0.61	10.4
TkA04G153050	`PF08581`	Tup_N	6	34	0.81	10.8
TkA04G153050	`PF05130`	FlgN	7	97	1.5	9.9
TkA04G153050	`PF06818`	Fez1	8	112	0.57	11.3
TkA04G153050	`PF01496`	V_ATPase_I	8	104	0.95	8.0
TkA04G153050	`PF17561`	TssO	8	64	1.3	9.7
TkA04G153050	`PF20849`	TelK_muzzle	10	94	0.073	13.8
TkA04G153050	`PF23649`	FKBP15	13	97	0.053	13.8
TkA04G153050	`PF04977`	DivIC	13	62	2.5	8.7
TkA04G153050	`PF07889`	DUF1664	13	65	5.1	7.9
TkA04G153050	`PF07714`	PK_Tyr_Ser-Thr	14	39	1e-39	137.1
TkA04G153050	`PF00069`	Pkinase	14	39	1.1e-33	117.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUH1`	Arabidopsis thaliana	sp\|Q8GUH1\|PUB33_ARATH U-box domain-containing protein 33	49.500%	Swiss-Prot	Medium
`Q94A51`	Arabidopsis thaliana	sp\|Q94A51\|PUB32_ARATH U-box domain-containing protein 32	48.900%	Swiss-Prot	Medium
`Q9FKG5`	Arabidopsis thaliana	sp\|Q9FKG5\|PUB51_ARATH U-box domain-containing protein 51	41.400%	Swiss-Prot	Medium
`Q5WA76`	Oryza sativa subsp. japonica	sp\|Q5WA76\|PUB70_ORYSJ U-box domain-containing protein 70	45.800%	Swiss-Prot	Medium
`Q0DR28`	Oryza sativa subsp. japonica	sp\|Q0DR28\|PUB57_ORYSJ U-box domain-containing protein 57	40.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card