TkA04G149780 | RubberDandelionOmics

Gene overview

TkA04G149780

Reference: TK1151 Chr: Chr04 Coordinates: 38774611-38775231 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · TkA04G149780|TK1151|cDNA

ATGCAAAATAAGGCATACCAGAATGAATCAAAACACAATGATCAAGAGGAATCAGAAACGGAATCCTCGGATCAATCCGAGTCTCAGCTGGTGAAAGATGAGTTTCCAGGTTATTCAGACGAGATTAAATCAAAGTTGAATAAATTAGCCAAGGGTTTGATAGCAGGAGGTCGCGAAATAGAGTGTACCGAATTGTATTCAACTGAGAAACTGTTCAAGTTTCTAGACATTCACGAGACAGCGTTCCGGAGGTGGAGAAA...

CDS

Download CDS FASTA

480 bp · TkA04G149780|TK1151|CDS

ATGCAAAATAAGGCATACCAGAATGAATCAAAACACAATGATCAAGAGGAATCAGAAACGGAATCCTCGGATCAATCCGAGTCTCAGCTGGTGAAAGATGAGTTTCCAGGTTATTCAGACGAGATTAAATCAAAGTTGAATAAATTAGCCAAGGGTTTGATAGCAGGAGGTCGCGAAATAGAGTGTACCGAATTGTATTCAACTGAGAAACTGTTCAAGTTTCTAGACATTCACGAGACAGCGTTCCGGAGGTGGAGAAA...

Protein

Download Protein FASTA

159 aa · TkA04G149780|TK1151|PROTEIN

MQNKAYQNESKHNDQEESETESSDQSESQLVKDEFPGYSDEIKSKLNKLAKGLIAGGREIECTELYSTEKLFKFLDIHETAFRRWRNYFPVTGYSSSKSQHHRSIQIQGRLRFSSEMFTLSIYTMDYLKYACEYRDTLAQVLPQIPITIPVPKTTFNRQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G149780`
TK1151 ID	TkA04G149780
OH-1004 ID	LXL04_035241
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G149780

Location Chr04:38774611-38775231 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13990`	Required for optimal tip growth of pollen tube.	EXO70C2 Is a Key Regulatory Factor for Optimal Tip Growth of Pollen.2017 · DOI: 10.1104/pp.16.01282 Regulation of Exocyst Function in Pollen Tube Growth by Phosphorylation of Exocyst Subunit EXO70C2.2020 · DOI: 10.3389/fpls.2020.609600

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035241 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006887 exocytosis Biological Process

GO:0015031 protein transport Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:2000280 regulation of root development Biological Process

GO:0000145 exocyst Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0005546 phosphatidylinositol-4,5-bisphosphate binding Molecular Function

KEGG gene cross-reference

ath:AT5G13150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.683

Rank 1 · TkA04G149780 · TK1151

Cytoplasm0.328

Rank 2 · TkA04G149780 · TK1151

Mitochondrion0.061

Rank 3 · TkA04G149780 · TK1151

Cell membrane0.031

Rank 4 · TkA04G149780 · TK1151

Endoplasmic reticulum0.021

Rank 5 · TkA04G149780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07065D1237-50 aa

PF03081Exo70_C25-81 aa

PF25170TPR_WDR3541-67 aa

PF03081Exo70_C120-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G149780	`PF07065`	D123	7	50	0.43	10.4
TkA04G149780	`PF03081`	Exo70_C	25	81	1.7e-06	28.1
TkA04G149780	`PF25170`	TPR_WDR35	41	67	0.26	11.9
TkA04G149780	`PF03081`	Exo70_C	120	145	1.7e-06	28.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFX6`	Arabidopsis thaliana	sp\|Q9FFX6\|E70C2_ARATH Exocyst complex component EXO70C2	36.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card