TkA04G148210 | RubberDandelionOmics

Gene overview

TkA04G148210

Reference: TK1151 Chr: Chr04 Coordinates: 38397692-38398457 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

471 bp · TkA04G148210|TK1151|cDNA

ATGTCACAACACTTGCCAGGAAGGAGTGATAATGAGATCAAAAACCATTGGCATTCTTGTCTAAAGAAGAGATATGCTCAATCAGATAACATAAAATCTCAACCTACGCCTTTAGACACATTAAATGAAGAATCCGCTTCCTCTAATTTGAATTCAGTAAGAACATGTCCACGTATCAAATCAATCGATGCCGAGCCTTTAGATTATTCAAAAGTAGCTGGTCTTGGAATTTCCCCAAAGATTTTATTTGCTGATTGGCT...

CDS

Download CDS FASTA

471 bp · TkA04G148210|TK1151|CDS

ATGTCACAACACTTGCCAGGAAGGAGTGATAATGAGATCAAAAACCATTGGCATTCTTGTCTAAAGAAGAGATATGCTCAATCAGATAACATAAAATCTCAACCTACGCCTTTAGACACATTAAATGAAGAATCCGCTTCCTCTAATTTGAATTCAGTAAGAACATGTCCACGTATCAAATCAATCGATGCCGAGCCTTTAGATTATTCAAAAGTAGCTGGTCTTGGAATTTCCCCAAAGATTTTATTTGCTGATTGGCT...

Protein

Download Protein FASTA

156 aa · TkA04G148210|TK1151|PROTEIN

MSQHLPGRSDNEIKNHWHSCLKKRYAQSDNIKSQPTPLDTLNEESASSNLNSVRTCPRIKSIDAEPLDYSKVAGLGISPKILFADWLLLDRFQSVNSSDVLSISRDTMYYSSSYQDTNVNEGSYSSHNQEGSRALFPQHIIIVENFYLVGEEGVEE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G148210`
TK1151 ID	TkA04G148210
OH-1004 ID	LXL04_011885
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	40.800
Protein coverage (%)	TK1151 62.821 / OH-1004 34.188 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G148210`
Location	Chr04:38397692-38398457 (+)
Description	Similar to LAF1: Transcription factor LAF1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011885` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000902 cell morphogenesis Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009585 red, far-red light phototransduction Biological Process GO:0009639 response to red or far red light Biological Process GO:0010018 far-red light signaling pathway Biological Process GO:0010087 phloem or xylem histogenesis Biological Process GO:0010089 xylem development Biological Process GO:0010091 trichome branching Biological Process GO:0010119 regulation of stomatal movement Biological Process GO:0010214 seed coat development Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process
KEGG gene cross-reference	ath:AT1G09540 ath:AT3G01140 ath:AT4G25560 ath:AT5G26660 ath:AT5G65230 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.903

Rank 1 · TkA04G148210 · TK1151

Cytoplasm0.234

Rank 2 · TkA04G148210 · TK1151

Mitochondrion0.025

Rank 3 · TkA04G148210 · TK1151

Cell membrane0.023

Rank 4 · TkA04G148210 · TK1151

Golgi apparatus0.012

Rank 5 · TkA04G148210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding2-20 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G148210	`PF00249`	Myb_DNA-binding	2	20	0.00017	22.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card