TkA04G147460 | RubberDandelionOmics

Gene overview

TkA04G147460

Reference: TK1151 Chr: Chr04 Coordinates: 38184116-38185324 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1061 bp · TkA04G147460|TK1151|cDNA

TTTATATTCTCTTTATTGTAAAAACACGAAATTACGGTATTTTCTTTCTTTTACTTTTTTGTCCCCTTCATAGTAGTAACTAGTAAGATATAAAAAAATGTCTTTCTTCTCAAACTAATAGAAAAAGTCGTAATAACAGGTATCACAATACGACCAAAACACTGAAATCTATGAATCCATAAAACTCGTACAAGCATCAAGTTGAAGATTATCAAATATGGATGTCCCACTATTGGAGACACTTAAAAAGGCTATAACCG...

CDS

Download CDS FASTA

648 bp · TkA04G147460|TK1151|CDS

ATGGATGTCCCACTATTGGAGACACTTAAAAAGGCTATAACCGCATACACAGGACTATCTCCAACAACTTTCGCCACCGTAGCAGCTTTGGGTCTCGCGGGCTACTATGTCGTCTCCGGTATGTTCGGTGGATCATCCGAGCATCATCTACAACAGAGGTCTAGATCATCGGAAGAAGAAGTGCAGCCTCTCCCGCCGCCGGTTCAGCTTGGCGAGATTTCCGAGGAGGAGTTGAAATCCTTCGATGGTAACGATTCTAA...

Protein

Download Protein FASTA

215 aa · TkA04G147460|TK1151|PROTEIN

MDVPLLETLKKAITAYTGLSPTTFATVAALGLAGYYVVSGMFGGSSEHHLQQRSRSSEEEVQPLPPPVQLGEISEEELKSFDGNDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLNGDLTGLGVFELEALQDWEYKFMSKYVKVGTIRKPEPAPESSTSDQPAESTQADHGSQPTETVVGETKEESIGENNKKE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G147460`
TK1151 ID	TkA04G147460
OH-1004 ID	LXL04_011883
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.300
Protein coverage (%)	TK1151 87.907 / OH-1004 79.098 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G147460

Location Chr04:38184116-38185324 (-)

Description Similar to MSBP1: Membrane steroid-binding protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48890`	Membrane steroid-binding protein 2.	No verified direct reference in this release
`At5g52240`	MSBP1 can bind to multiple steroid compounds with different affinities.	No verified direct reference in this release
`At2g24940`	Probable steroid-binding protein 3.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0502600`	Binds multiple steroid compounds (By similarity).	Differential expression of GS5 regulates grain size in rice.2015 · DOI: 10.1093/jxb/erv058
`Os10g0502500`	Binds multiple steroid compounds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011883 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030308 negative regulation of cell growth Biological Process

GO:1901141 regulation of lignin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0010008 endosome membrane Cellular Component

KEGG gene cross-reference

ath:AT2G24940

ath:AT3G48890

ath:AT5G52240

dosa:Os10g0502500

dosa:Os10g0502600

osa:4349045

osa:4349046

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.322

Rank 1 · TkA04G147460 · TK1151

Endoplasmic reticulum0.256

Rank 2 · TkA04G147460 · TK1151

Cytoplasm0.193

Rank 3 · TkA04G147460 · TK1151

Peroxisome0.171

Rank 4 · TkA04G147460 · TK1151

Nucleus0.136

Rank 5 · TkA04G147460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00173Cyt-b575-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G147460	`PF00173`	Cyt-b5	75	167	3.4e-12	46.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2Z4`	Arabidopsis thaliana	sp\|Q9M2Z4\|MSBP2_ARATH Membrane steroid-binding protein 2	76.800%	Swiss-Prot	High
`Q9XFM6`	Arabidopsis thaliana	sp\|Q9XFM6\|MSBP1_ARATH Membrane steroid-binding protein 1	63.000%	Swiss-Prot	High
`Q9SK39`	Arabidopsis thaliana	sp\|Q9SK39\|SBP3_ARATH Probable steroid-binding protein 3	48.500%	Swiss-Prot	Low
`Q9FVZ7`	Oryza sativa subsp. japonica	sp\|Q9FVZ7\|MSBP1_ORYSJ Membrane steroid-binding protein 1	61.600%	Swiss-Prot	High
`Q9FVZ9`	Oryza sativa subsp. japonica	sp\|Q9FVZ9\|MSBP2_ORYSJ Membrane steroid-binding protein 2	78.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card