TkA04G146570 | RubberDandelionOmics

Gene overview

TkA04G146570

Reference: TK1151 Chr: Chr04 Coordinates: 37967248-37969658 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1078 bp · TkA04G146570|TK1151|cDNA

CCTTGACAAAACACACTCCCTCTTTTCTCCACTAAACTATAACACTCATAACTACAAATAGCTTCTCCTTTGGCGGTGGACATTACAAAGGCATCGAACTGTTCTTTTATCTTCAACCCATCCATCATCCAAGATAACATCCATGAGCAGAAGCATGGACCTCCATTTGCATTCCAGACTTCCAGACGAAATACCTGAGAATTTAATCGAGTTTTTTCAAGATGATGAAGGTCTTACTTACGAAGAAGCTCTGTTACAAC...

CDS

Download CDS FASTA

702 bp · TkA04G146570|TK1151|CDS

ATGAGCAGAAGCATGGACCTCCATTTGCATTCCAGACTTCCAGACGAAATACCTGAGAATTTAATCGAGTTTTTTCAAGATGATGAAGGTCTTACTTACGAAGAAGCTCTGTTACAACAGGAAAGCATGTATCAATCATTTCAAGAACGTGACAAGAGCAAGAATGTGGTCGCATTTGACGATGACATCATCCATTGGGGTCATTTGTTGGAAGAAGAAGAGGAAGAAGGTGAATGTTCGAGTCATGAACAGGAAGCCAT...

Protein

Download Protein FASTA

233 aa · TkA04G146570|TK1151|PROTEIN

MSRSMDLHLHSRLPDEIPENLIEFFQDDEGLTYEEALLQQESMYQSFQERDKSKNVVAFDDDIIHWGHLLEEEEEEGECSSHEQEAIDEALARSLQELGDGFDDIYISEHSGTQSSTTTPPSRSQGANSNSMQDSIDPDGMEYEELLHLAEAIGVENRGISESRISQLPTSKYRYGLFSKNKKKEENCVICQSEYTFGDRLITLPCLHQYHTKCITDWLKLKKNCPICQKEVI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G146570`
TK1151 ID	TkA04G146570
OH-1004 ID	LXL04_035285
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 18.625 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G146570

Location Chr04:37967248-37969658 (-)

Description Similar to BB: E3 ubiquitin-protein ligase BIG BROTHER

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27940`	RING-H2 finger protein ATL57.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035285 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009845 seed germination Biological Process

GO:0009908 flower development Biological Process

GO:0010218 response to far red light Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0046621 negative regulation of organ growth Biological Process

GO:0048437 floral organ development Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:1900057 positive regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G19910

ath:AT3G63530

ath:AT4G34040

ath:AT5G42940

dosa:Os04g0648800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.563

Rank 1 · TkA04G146570 · TK1151

Nucleus0.527

Rank 2 · TkA04G146570 · TK1151

Cell membrane0.066

Rank 3 · TkA04G146570 · TK1151

Endoplasmic reticulum0.050

Rank 4 · TkA04G146570 · TK1151

Lysosome / Vacuole0.050

Rank 5 · TkA04G146570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23412zf_RING_Vps845-59 aa

PF15750UBZ_FAAP2087-97 aa

PF25420zf-C2H2_ZN292178-194 aa

PF14570zf-RING_4183-195 aa

PF12678zf-rbx1184-229 aa

PF29452FAR1_N184-228 aa

PF17120zf-RING_16184-226 aa

PF13920zf-C3HC4_3185-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G146570	`PF23412`	zf_RING_Vps8	45	59	0.06	13.9
TkA04G146570	`PF15750`	UBZ_FAAP20	87	97	0.73	10.5
TkA04G146570	`PF25420`	zf-C2H2_ZN292	178	194	0.044	14.5
TkA04G146570	`PF14570`	zf-RING_4	183	195	1.1	9.8
TkA04G146570	`PF12678`	zf-rbx1	184	229	2.6e-09	37.9
TkA04G146570	`PF29452`	FAR1_N	184	228	0.012	16.3
TkA04G146570	`PF17120`	zf-RING_16	184	226	0.05	13.9
TkA04G146570	`PF13920`	zf-C3HC4_3	185	232	7.9e-06	26.3
TkA04G146570	`PF23413`	zf_RING_Vps8_fungal	186	193	0.0065	16.4
TkA04G146570	`PF15750`	UBZ_FAAP20	186	196	0.73	10.5
TkA04G146570	`PF13639`	zf-RING_2	187	229	3.2e-13	50.4
TkA04G146570	`PF17123`	zf-RING_11	187	215	4.8e-08	33.3
TkA04G146570	`PF14634`	zf-RING_5	187	230	0.00019	22.1
TkA04G146570	`PF25998`	U-box_ZFPL1	187	220	0.26	12.4
TkA04G146570	`PF13923`	zf-C3HC4_2	188	228	8.5e-08	32.6
TkA04G146570	`PF00097`	zf-C3HC4	188	228	3.4e-07	30.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJJ7`	Arabidopsis thaliana	sp\|Q9SJJ7\|ATL57_ARATH RING-H2 finger protein ATL57	34.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card