RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G144220
Reference: TK1151 Chr: Chr04 Coordinates: 37340592-37344037 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1572 bp · TkA04G144220|TK1151|cDNA

AAGGAACTCATTTTTATTGCCTTGGCTTAACTTTTCCGGTGCCTTTCCTTCTTTGTTTTCATAGTAGACAAAGGGAATACAAGATAAATGATGAATACGGAAACCTATCTGCATTTGTGGTCTCAAAGTAAAGAGATCCTTTACATTATCAACCCAAAAGAAGATCCTTCATGTCTCATGAACTTCTTCCAAATACTCGACCCTATCAATTAATCCTGTCCTAGAATCCTGTTCAGTCTACTGTTTTCTCTAGGGTTTCG...

CDS

Download CDS FASTA

633 bp · TkA04G144220|TK1151|CDS

ATGGTGAGAGGAAAGGTTGAGCTGAAAAGAATAGAGAACTCAACAAGCAGGCAAGTTACTTTCACGAAGAGGAGAACTGGGCTTTTAAAGAAGGCTTATGAGCTTTCAATTCTTTGCGATGCTGAAGTTTCTTTGATTATTTTCTCTCAAAAGGGAAAACTCTATGAGTTTTCAAGCTCCAACATGCAGAAGACAGTAGAAAAGTATCGTGCACATGTTAAGAAAGTTGAAACCCGCATTCCTGAAAATGAAGTACACAC...

Protein

Download Protein FASTA

210 aa · TkA04G144220|TK1151|PROTEIN

MVRGKVELKRIENSTSRQVTFTKRRTGLLKKAYELSILCDAEVSLIIFSQKGKLYEFSSSNMQKTVEKYRAHVKKVETRIPENEVHTQQMKHEIAVIQQQMKQLEVSQRRLLGQDLVSCSVEELSGLDSKLEHTLRTIRTRKIQLFKEQVEKLQAKERYLLEENARLCQENSSLCQKSCQHITIPPQQYSIKQKVPATCNHSSQFLEVET

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G144220
TK1151 IDTkA04G144220
OH-1004 IDLXL04_026790
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)55.100
Protein coverage (%)TK1151 79.524 / OH-1004 76.606
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G144220
LocationChr04:37340592-37344037 (-)
DescriptionSimilar to SOC1: MADS-box protein SOC1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g62165 MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time.
The Arabidopsis SOC1-like genes AGL42, AGL71 and AGL72 promote flowering in the shoot apical and axillary meristems.2011 · DOI: 10.1111/j.1365-313x.2011.04653.x
At2g45660 May participate in transcriptional regulation of flowering time and floral development.
The AGAMOUS-LIKE 20 MADS domain protein integrates floral inductive pathways in Arabidopsis.2000 · DOI: 10.1101/gad.813600
Direct interaction of AGL24 and SOC1 integrates flowering signals in Arabidopsis.2008 · DOI: 10.1242/dev.020255
The Arabidopsis floral meristem identity genes AP1, AGL24 and SVP directly repress class B and C floral homeotic genes.2009 · DOI: 10.1111/j.1365-313x.2009.03985.x
At4g22950 Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner.
Polycomb-group proteins repress the floral activator AGL19 in the FLC-independent vernalization pathway.2006 · DOI: 10.1101/gad.377206
At4g11880 Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem.
The MADS transcription factor XAL2/AGL14 modulates auxin transport during Arabidopsis root development by regulating PIN expression.2013 · DOI: 10.1038/emboj.2013.216

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2Z9Q7 Probable transcription factor. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026790 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0009409 response to cold Biological Process
GO:0009739 response to gibberellin Biological Process
GO:0009838 abscission Biological Process
GO:0009908 flower development Biological Process
GO:0009909 regulation of flower development Biological Process
GO:0009911 positive regulation of flower development Biological Process
GO:0010048 vernalization response Biological Process
GO:0010076 maintenance of floral meristem identity Biological Process
GO:0010077 maintenance of inflorescence meristem identity Biological Process
GO:0010082 regulation of root meristem growth Biological Process
KEGG gene cross-reference
ath:AT2G45660
ath:AT4G11880
ath:AT4G22950
ath:AT5G62165
dosa:Os03g0122600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.939
Rank 1 · TkA04G144220 · TK1151
Cytoplasm0.157
Rank 2 · TkA04G144220 · TK1151
Cell membrane0.023
Rank 3 · TkA04G144220 · TK1151
Mitochondrion0.013
Rank 4 · TkA04G144220 · TK1151
Endoplasmic reticulum0.011
Rank 5 · TkA04G144220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319SRF-TF10-57 aa
PF29997SPC25_N10-38 aa
PF19776DUF626211-39 aa
PF16755Beta-prop_NUP159_NUP21413-147 aa
PF28586DUF844035-69 aa
PF19220Rod_CreS38-132 aa
PF05960DUF88550-169 aa
PF09763Sec3_CC57-116 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G144220PF00319SRF-TF10571.9e-2692.0
TkA04G144220PF29997SPC25_N10381.110.3
TkA04G144220PF19776DUF626211390.7610.7
TkA04G144220PF16755Beta-prop_NUP159_NUP214131470.1512.0
TkA04G144220PF28586DUF844035691.510.2
TkA04G144220PF19220Rod_CreS381320.007616.2
TkA04G144220PF05960DUF885501690.02614.8
TkA04G144220PF09763Sec3_CC571160.04814.2
TkA04G144220PF07889DUF1664581062.09.2
TkA04G144220PF06008Laminin_I601660.01815.5
TkA04G144220PF29997SPC25_N601051.110.3
TkA04G144220PF30854Par-4_C611060.01815.9
TkA04G144220PF24555CC4_CEP85611112.69.3
TkA04G144220PF06005ZapB621040.06414.5
TkA04G144220PF06156YabA621050.06714.5
TkA04G144220PF19776DUF6262621110.7610.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FIS1Arabidopsis thalianasp|Q9FIS1|AGL42_ARATH MADS-box protein AGL4261.100%Swiss-ProtHigh
O64645Arabidopsis thalianasp|O64645|SOC1_ARATH MADS-box protein SOC156.900%Swiss-ProtHigh
O82743Arabidopsis thalianasp|O82743|AGL19_ARATH Agamous-like MADS-box protein AGL1952.700%Swiss-ProtHigh
Q38838Arabidopsis thalianasp|Q38838|AGL14_ARATH Agamous-like MADS-box protein AGL1453.000%Swiss-ProtHigh
A2Z9Q7Oryza sativa subsp. indicasp|A2Z9Q7|MAD56_ORYSI MADS-box transcription factor 5651.500%Swiss-ProtHigh

JBrowse

View in Genome Browser