TkA04G143200 | RubberDandelionOmics

Gene overview

TkA04G143200

Reference: TK1151 Chr: Chr04 Coordinates: 37025300-37025650 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

318 bp · TkA04G143200|TK1151|cDNA

ATGCTTGGCGGTCAAAATTCATCCACCACCGCCGTCTCCGAGCAACAGCAGGACCCCGACAATGTCGACTCCGACTTAGTTGTCATCCTCGCCGCCCTTCTGTGCGCCCTAATCTGCGTCCTCGGCCTCGTCGCAGTGGCTCGCTGCACCTGGATCCGTCGGATCTCTGGCATAGCCGCAGCGAACAAAGGCCTAAAGAAAAAAGAGTTGAAAACTCTTCCGAAGCTCACCTACTCCACAGAAACAATGGCCGAGAAATT...

CDS

Download CDS FASTA

318 bp · TkA04G143200|TK1151|CDS

ATGCTTGGCGGTCAAAATTCATCCACCACCGCCGTCTCCGAGCAACAGCAGGACCCCGACAATGTCGACTCCGACTTAGTTGTCATCCTCGCCGCCCTTCTGTGCGCCCTAATCTGCGTCCTCGGCCTCGTCGCAGTGGCTCGCTGCACCTGGATCCGTCGGATCTCTGGCATAGCCGCAGCGAACAAAGGCCTAAAGAAAAAAGAGTTGAAAACTCTTCCGAAGCTCACCTACTCCACAGAAACAATGGCCGAGAAATT...

Protein

Download Protein FASTA

105 aa · TkA04G143200|TK1151|PROTEIN

MLGGQNSSTTAVSEQQQDPDNVDSDLVVILAALLCALICVLGLVAVARCTWIRRISGIAAANKGLKKKELKTLPKLTYSTETMAEKFSDCAICLTEFVAGDEIRV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G143200`
TK1151 ID	TkA04G143200
OH-1004 ID	LXL04_006639
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.900
Protein coverage (%)	TK1151 100.000 / OH-1004 61.376 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G143200

Location Chr04:37025300-37025650 (-)

Description Similar to ATL8: RING-H2 finger protein ATL8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20823`	May be involved in the early steps of the plant defense signaling pathway.	No verified direct reference in this release
`At1g76410`	RING-H2 finger protein ATL8.	No verified direct reference in this release
`At4g35480`	E3 ubiquitin-protein ligase that possess E3 ubiquitin ligase activity in vitro and mediates protein monoubiquitination.	Ligand-induced monoubiquitination of BIK1 regulates plant immunity.2020 · DOI: 10.1038/s41586-020-2210-3
`At2g17450`	E3 ubiquitin-protein ligase that possess E3 ubiquitin ligase activity in vitro and mediates protein monoubiquitination.	Ligand-induced monoubiquitination of BIK1 regulates plant immunity.2020 · DOI: 10.1038/s41586-020-2210-3

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006639 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006513 protein monoubiquitination Biological Process

GO:0006952 defense response Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010966 regulation of phosphate transport Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G20823

ath:AT1G49230

ath:AT1G76410

ath:AT2G17450

ath:AT4G35480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.352

Rank 1 · TkA04G143200 · TK1151

Endoplasmic reticulum0.258

Rank 2 · TkA04G143200 · TK1151

Lysosome / Vacuole0.238

Rank 3 · TkA04G143200 · TK1151

Cytoplasm0.160

Rank 4 · TkA04G143200 · TK1151

Golgi apparatus0.129

Rank 5 · TkA04G143200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14991MLANA31-82 aa

PF17123zf-RING_1189-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G143200	`PF14991`	MLANA	31	82	0.27	12.2
TkA04G143200	`PF17123`	zf-RING_11	89	105	0.0019	18.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LM69`	Arabidopsis thaliana	sp\|Q9LM69\|ATL80_ARATH RING-H2 finger protein ATL80	60.400%	Swiss-Prot	High
`Q8LC69`	Arabidopsis thaliana	sp\|Q8LC69\|ATL8_ARATH RING-H2 finger protein ATL8	61.100%	Swiss-Prot	High
`Q9ZT49`	Arabidopsis thaliana	sp\|Q9ZT49\|ATL45_ARATH Probable E3 ubiquitin-protein ligase ATL45	49.100%	Swiss-Prot	Medium
`O22755`	Arabidopsis thaliana	sp\|O22755\|ATL44_ARATH Probable E3 ubiquitin-protein ligase ATL44	54.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card