TkA04G142480 | RubberDandelionOmics

Gene overview

TkA04G142480

Reference: TK1151 Chr: Chr04 Coordinates: 36853654-36856630 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1676 bp · TkA04G142480|TK1151|cDNA

TTAATATTGTGAATATGTAAATTAAAATATAAATTATCCATCAATTTACGAATATTTTAGTTATATTTCCCCTATTTAATTTTTATATTTCTATTTTCCTACTTTAATTTTCTCCCTTCTTTTCCTGCAAAACCCTAATTTCATTTCCTTCAAAAATTTCCAGCAAGCAAACAAAAATTGATTTTGTATTTTCTTTTTTTCTTTTTTACTGTTGAAAATCGCTTATTCTGCTACAGCGAAAATTACGATCAACCAACTGT...

CDS

Download CDS FASTA

501 bp · TkA04G142480|TK1151|CDS

ATGGAAGGTCAAGAAGAGCATCATAATTCCGGTACAGTTTCACTACCGCTGCCGGTTGTAGTAGTTGGCGAGGAAGGAAATTTCAGTGGATCAACGGTGGCGCCACCACCACCGGCGGAAGCGCTGGTGGGTGCTGCGACGCCTGGCTCAGATGGTTTTAAGAAAAAGAGGGGAAGACCGAGGAAGTACGGACCGGATGGAAAACCTAAAGTAACCTTATCTCCGATGCCTATTTCCTCATCGATTCCCCTCTCCGGAGA...

Protein

Download Protein FASTA

166 aa · TkA04G142480|TK1151|PROTEIN

MEGQEEHHNSGTVSLPLPVVVVGEEGNFSGSTVAPPPPAEALVGAATPGSDGFKKKRGRPRKYGPDGKPKVTLSPMPISSSIPLSGDFPGWKQKQEKPVTSVKRKQKLEFRTSGAQVASSIGANFTPHVITVNSGEDVNMKIISFAQQGTKAICVLAANGAVQMLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G142480`
TK1151 ID	TkA04G142480
OH-1004 ID	LXL04_035323
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.590 / OH-1004 52.769 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G142480

Location Chr04:36853654-36856630 (-)

Description Similar to AHL6: AT-hook motif nuclear-localized protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25320`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs) (By similarity).	Cell-to-cell movement of two interacting AT-hook factors in Arabidopsis root vascular tissue patterning.2013 · DOI: 10.1105/tpc.112.102210
`At5g62260`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release
`At5g51590`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs) (By similarity).	Cell-to-cell movement of two interacting AT-hook factors in Arabidopsis root vascular tissue patterning.2013 · DOI: 10.1105/tpc.112.102210
`At4g12080`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	Identification of a novel plant MAR DNA binding protein localized on chromosomal surfaces.2004 · DOI: 10.1007/s11103-004-3249-5
`At4g22770`	Transcription factor that specifically binds AT-rich DNA sequences related to the nuclear matrix attachment regions (MARs).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035323 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010089 xylem development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0098687 chromosomal region Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003680 minor groove of adenine-thymine-rich DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT4G12080

ath:AT4G22770

ath:AT4G25320

ath:AT5G51590

ath:AT5G62260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · TkA04G142480 · TK1151

Cytoplasm0.089

Rank 2 · TkA04G142480 · TK1151

Cell membrane0.031

Rank 3 · TkA04G142480 · TK1151

Endoplasmic reticulum0.025

Rank 4 · TkA04G142480 · TK1151

Plastid0.015

Rank 5 · TkA04G142480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03479PCC18-22 aa

PF03535Paxillin31-125 aa

PF02178AT_hook54-65 aa

PF03479PCC122-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G142480	`PF03479`	PCC	18	22	2.2e-09	38.1
TkA04G142480	`PF03535`	Paxillin	31	125	0.046	14.2
TkA04G142480	`PF02178`	AT_hook	54	65	0.042	14.4
TkA04G142480	`PF03479`	PCC	122	163	2.2e-09	38.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SB31`	Arabidopsis thaliana	sp\|Q9SB31\|AHL3_ARATH AT-hook motif nuclear-localized protein 3	53.800%	Swiss-Prot	Medium
`Q9LVB0`	Arabidopsis thaliana	sp\|Q9LVB0\|AHL6_ARATH AT-hook motif nuclear-localized protein 6	50.400%	Swiss-Prot	High
`Q9FHM5`	Arabidopsis thaliana	sp\|Q9FHM5\|AHL4_ARATH AT-hook motif nuclear-localized protein 4	43.600%	Swiss-Prot	Medium
`Q8VYJ2`	Arabidopsis thaliana	sp\|Q8VYJ2\|AHL1_ARATH AT-hook motif nuclear-localized protein 1	50.800%	Swiss-Prot	Medium
`O49658`	Arabidopsis thaliana	sp\|O49658\|AHL2_ARATH AT-hook motif nuclear-localized protein 2	52.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card