TkA04G141720 | RubberDandelionOmics

Gene overview

TkA04G141720

Reference: TK1151 Chr: Chr04 Coordinates: 36629479-36632825 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2202 bp · TkA04G141720|TK1151|cDNA

GAGGAGTCAAAACGTAAATAAATGAAAGTTATGTGGCCATAGACGATAGAAGCTAACAAGATTCTGAAAACGTTTTAGCTCCGAAAAACCCACTTGAAGAATTCACATTCCGATAATGATTCCTAAAACCCTCTCCCTCACCTCCTTCTCCACATTCCTCCTTCCTCATCAATTCAAAACCCCCAAATTTTGCAATTCGAGTCGGACTATAGTCATTTGCAAACCCATTAATTCACAAACCCAACAACAGAATCAACCAC...

CDS

Download CDS FASTA

1710 bp · TkA04G141720|TK1151|CDS

ATGATTCCTAAAACCCTCTCCCTCACCTCCTTCTCCACATTCCTCCTTCCTCATCAATTCAAAACCCCCAAATTTTGCAATTCGAGTCGGACTATAGTCATTTGCAAACCCATTAATTCACAAACCCAACAACAGAATCAACCACCCCTTCAGACACAATTATCAGTTGCTTCACCTGAATCACAAGGAACCGGAGCTGCCGCCCCGACCCGAGGGGATATCTTCCTTGAACGACAACAGCTCTTGGCGGCTTCAGCTTC...

Protein

Download Protein FASTA

569 aa · TkA04G141720|TK1151|PROTEIN

MIPKTLSLTSFSTFLLPHQFKTPKFCNSSRTIVICKPINSQTQQQNQPPLQTQLSVASPESQGTGAAAPTRGDIFLERQQLLAASASALVIEKKKKKKKAKTSGSLKSTSTSTYSCYGCGAPLQISETDAPGYVEPETYELKKKHRQLRTILCGRCRLLSHGHMITAVGGNGGYAGGKQFVTAEELREKLRHLRHEKALIVKLVDIVDFNGSFLAHVRDLAGANPIILVVTKVDLLPKGTDFDCIGDWVVEATMRKKLNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G141720`
TK1151 ID	TkA04G141720
OH-1004 ID	LXL04_035338
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G141720

Location Chr04:36629479-36632825 (-)

Description Similar to NOA1: NO-associated protein 1, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47450`	Exhibits cGTPase activity.	AtNOS/AtNOA1 is a functional Arabidopsis thaliana cGTPase and not a nitric-oxide synthase.2008 · DOI: 10.1074/jbc.m804838200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0104700`	Produces nitric oxide (NO) which is a messenger molecule involved in hormonal signaling and defense responses in plant.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035338 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006809 nitric oxide biosynthetic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009657 plastid organization Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010027 thylakoid membrane organization Biological Process

KEGG gene cross-reference

ath:AT3G47450

ath:AT3G57180

bsu:BSU25670

bta:539773

dosa:Os02g0104700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.568

Rank 1 · TkA04G141720 · TK1151

Plastid0.364

Rank 2 · TkA04G141720 · TK1151

Nucleus0.062

Rank 3 · TkA04G141720 · TK1151

Cytoplasm0.034

Rank 4 · TkA04G141720 · TK1151

Cell membrane0.012

Rank 5 · TkA04G141720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01926MMR_HSR199-147 aa

PF03193RsgA_GTPase225-356 aa

PF01926MMR_HSR1290-360 aa

PF21516YqeH-like_C426-539 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G141720	`PF01926`	MMR_HSR1	99	147	8e-08	33.1
TkA04G141720	`PF03193`	RsgA_GTPase	225	356	0.0053	17.3
TkA04G141720	`PF01926`	MMR_HSR1	290	360	8e-08	33.1
TkA04G141720	`PF21516`	YqeH-like_C	426	539	1.5e-13	51.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q66GP9`	Arabidopsis thaliana	sp\|Q66GP9\|NOA1_ARATH NO-associated protein 1, chloroplastic/mitochondrial	63.700%	Swiss-Prot	High
`Q6YPG5`	Oryza sativa subsp. japonica	sp\|Q6YPG5\|NOS_ORYSJ Putative nitric oxide synthase	64.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card