TkA04G139740 | RubberDandelionOmics

Gene overview

TkA04G139740

Reference: TK1151 Chr: Chr04 Coordinates: 36186047-36186982 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

804 bp · TkA04G139740|TK1151|cDNA

TCCCTCCCTCCCTCGTTCATTCAACTACTCAACCATTTATTCCTCACTTATATAAATCTCCTTTCATTACACCTTATTTTCCACTTCAAAATTCATCACTTCCTTATAGTCCATCCTCTAACATCTGCAACAATGGCTTCCCCTCACGAATCTTCAACTCTAGACCTCATCCGTCAACACCTTCTCATTGACGACAAATCTTTCCATGAAACTGTCAGAAAGTCTGTTTCCAGTGAAACTGTTGTCAGTGATGGTAATAA...

CDS

Download CDS FASTA

804 bp · TkA04G139740|TK1151|CDS

TCCCTCCCTCCCTCGTTCATTCAACTACTCAACCATTTATTCCTCACTTATATAAATCTCCTTTCATTACACCTTATTTTCCACTTCAAAATTCATCACTTCCTTATAGTCCATCCTCTAACATCTGCAACAATGGCTTCCCCTCACGAATCTTCAACTCTAGACCTCATCCGTCAACACCTTCTCATTGACGACAAATCTTTCCATGAAACTGTCAGAAAGTCTGTTTCCAGTGAAACTGTTGTCAGTGATGGTAATAA...

Protein

Download Protein FASTA

267 aa · TkA04G139740|TK1151|PROTEIN

SLPPSFIQLLNHLFLTYINLLSLHLIFHFKIHHFLIVHPLTSATMASPHESSTLDLIRQHLLIDDKSFHETVRKSVSSETVVSDGNNNNSFKERKPSLNISIPFPPPLVAPVGVRQRPWGKFAAEIRDPNKKGTRVWLGTFDTAVDAAKAYDRAAFKLRGSKAILNFPLDIGYAEEAAVVPAVKSNTRKRVVRDTGPLNIKSQKVPKVEPYTEESVALMTDAGFGPLTPSCWTTVWDFVDGNGKGIFEVPPLSPYPNINF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G139740`
TK1151 ID	TkA04G139740
OH-1004 ID	LXL04_012080
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	53.600
Protein coverage (%)	TK1151 83.146 / OH-1004 99.655 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G139740

Location Chr04:36186047-36186982 (-)

Description Similar to ERF5: Ethylene-responsive transcription factor 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51190`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g61600`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g47230`	Acts as a transcriptional activator.	Arabidopsis ethylene-responsive element binding factors act as transcriptional activators or repressors of GCC box-mediated gene expression.2000 · DOI: 10.1105/tpc.12.3.393

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012080 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009733 response to auxin Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051301 cell division Biological Process

GO:0070482 response to oxygen levels Biological Process

KEGG gene cross-reference

ath:AT5G47230

ath:AT5G51190

ath:AT5G61600

nsy:104249597

nta:107790518

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.942

Rank 1 · TkA04G139740 · TK1151

Cytoplasm0.107

Rank 2 · TkA04G139740 · TK1151

Cell membrane0.036

Rank 3 · TkA04G139740 · TK1151

Endoplasmic reticulum0.035

Rank 4 · TkA04G139740 · TK1151

Plastid0.023

Rank 5 · TkA04G139740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP2112-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G139740	`PF00847`	AP2	112	161	1.6e-14	54.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY90`	Arabidopsis thaliana	sp\|Q8VY90\|EF105_ARATH Ethylene-responsive transcription factor ERF105	44.900%	Swiss-Prot	Medium
`Q9FKG1`	Arabidopsis thaliana	sp\|Q9FKG1\|EF104_ARATH Ethylene-responsive transcription factor ERF104	41.200%	Swiss-Prot	Medium
`O80341`	Arabidopsis thaliana	sp\|O80341\|EF102_ARATH Ethylene-responsive transcription factor 5	43.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card