TkA04G139310 | RubberDandelionOmics

Gene overview

TkA04G139310

Reference: TK1151 Chr: Chr04 Coordinates: 36100765-36105069 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2386 bp · TkA04G139310|TK1151|cDNA

TTTTGGCCAAACTCTATGCCTTTTAAATCATTAACTATCCTAAGTTGCTAACTATGTACCCAAACTCGCTCTAAGATCTTTCTTCGGATTTCGCGCTTTTTTATTTAGAGGTCGAAAAGCAATTAAACCCTCACCCTCTTCGACCCTTCTCTCTCCCCTTTCTCTCTCTCACATAGTGACACACCTTCTCTGTCACACAAATATCGGTCCTAGGATCTGCTTTCCAGCTTCGAATTCACGATACTTTACGTCCTCAATTG...

CDS

Download CDS FASTA

1893 bp · TkA04G139310|TK1151|CDS

ATGGAGACCTTGCTCCAGTCTTGCCCCATTTTCACAGCCAAGGCTTCGGTGAGATCGTCTGTTGATAGGCAATTGGCCTTCTCTTCTTTTGCCATTAATAAACAGAGGAATTGTAATGTGAAGTTAAGGGCGATAAGCCGGAGCTCTCAAGATGGATCTTCTTCTATTGAAGATGTAAGGAAGGATGGCATGTTATTGGGTGCTGATAAAGACGAATCTGGTTCGGTCGTTGGATTTCATCTGATTCCTCAATCTGGTGA...

Protein

Download Protein FASTA

630 aa · TkA04G139310|TK1151|PROTEIN

METLLQSCPIFTAKASVRSSVDRQLAFSSFAINKQRNCNVKLRAISRSSQDGSSSIEDVRKDGMLLGADKDESGSVVGFHLIPQSGEIEISNSHDTTSNGKEELITDDDSVKTTSAEVTYNIVFVTSEAAPYSKTGGLGDVCGSLPIALAERGHRVMVVSPRYLNGGPADKKFAGAIDLDCRIKVSCSGGVQEVAFFHEYRAGVDWVFVDHPSYHRPGNPYGDAYGAFGDNQFRFTLLCHAACEAPLVLPLGGFTYGEKC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G139310`
TK1151 ID	TkA04G139310
OH-1004 ID	LXL04_035352
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G139310

Location Chr04:36100765-36105069 (-)

Description Similar to Soluble starch synthase 1, chloroplastic/amyloplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24300`	Involved in the synthesis of short glycan chains within amylopectin in leaves.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0160700`	Involved in starch synthesis in endosperm amyloplasts.	No verified direct reference in this release
`UniProt: A2Y9M4`	Soluble starch synthase 1, chloroplastic/amyloplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035352 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009960 endosperm development Biological Process

GO:0010021 amylopectin biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004373 alpha-1,4-glucan glucosyltransferase (UDP-glucose donor) activity Molecular Function

GO:0009011 alpha-1,4-glucan glucosyltransferase (ADP-glucose donor) activity Molecular Function

KEGG gene cross-reference

ath:AT5G24300

sot:102600045

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.909

Rank 1 · TkA04G139310 · TK1151

Cytoplasm0.051

Rank 2 · TkA04G139310 · TK1151

Mitochondrion0.042

Rank 3 · TkA04G139310 · TK1151

Peroxisome0.041

Rank 4 · TkA04G139310 · TK1151

Golgi apparatus0.037

Rank 5 · TkA04G139310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08323Glyco_transf_5121-379 aa

PF20706GT4-conflict132-163 aa

PF00534Glycos_transf_1435-585 aa

PF13692Glyco_trans_1_4437-550 aa

PF20706GT4-conflict441-612 aa

PF08323Glyco_transf_5540-550 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G139310	`PF08323`	Glyco_transf_5	121	379	1.2e-64	219.0
TkA04G139310	`PF20706`	GT4-conflict	132	163	0.00036	20.3
TkA04G139310	`PF00534`	Glycos_transf_1	435	585	2.6e-15	57.1
TkA04G139310	`PF13692`	Glyco_trans_1_4	437	550	1.6e-13	51.9
TkA04G139310	`PF20706`	GT4-conflict	441	612	0.00036	20.3
TkA04G139310	`PF08323`	Glyco_transf_5	540	550	1.2e-64	219.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNF2`	Arabidopsis thaliana	sp\|Q9FNF2\|SSY1_ARATH Starch synthase 1, chloroplastic/amyloplastic	70.900%	Swiss-Prot	High
`Q0DEC8`	Oryza sativa subsp. japonica	sp\|Q0DEC8\|SSY1_ORYSJ Soluble starch synthase 1, chloroplastic/amyloplastic	73.900%	Swiss-Prot	High
`A2Y9M4`	Oryza sativa subsp. indica	sp\|A2Y9M4\|SSY1_ORYSI Soluble starch synthase 1, chloroplastic/amyloplastic	73.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card