TkA04G137390 | RubberDandelionOmics

Gene overview

TkA04G137390

Reference: TK1151 Chr: Chr04 Coordinates: 35681107-35687302 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1392 bp · TkA04G137390|TK1151|cDNA

ATGGATATTGGGTGGGGCAGCGATGTGCGCTACGTCGCGTATGTCATGTTTGACAAGTTAAATGGGTTTCTGGGATTGCCTGTTGAATTTGAACCTGAAATCCTCTGTCGATCTCCTAATGCGGTTGTGCGAAGTGCATTACCTTATCATACTGAAATTGATATTGATATATTACATCACCAAACTCTTCATCTTCTCCATGCATCCCTCCCAAACACAAGACCGAATGCACAAAGACACATAGTGGTGCATTTGAGGAT...

CDS

Download CDS FASTA

1392 bp · TkA04G137390|TK1151|CDS

ATGGATATTGGGTGGGGCAGCGATGTGCGCTACGTCGCGTATGTCATGTTTGACAAGTTAAATGGGTTTCTGGGATTGCCTGTTGAATTTGAACCTGAAATCCTCTGTCGATCTCCTAATGCGGTTGTGCGAAGTGCATTACCTTATCATACTGAAATTGATATTGATATATTACATCACCAAACTCTTCATCTTCTCCATGCATCCCTCCCAAACACAAGACCGAATGCACAAAGACACATAGTGGTGCATTTGAGGAT...

Protein

Download Protein FASTA

463 aa · TkA04G137390|TK1151|PROTEIN

MDIGWGSDVRYVAYVMFDKLNGFLGLPVEFEPEILCRSPNAVVRSALPYHTEIDIDILHHQTLHLLHASLPNTRPNAQRHIVVHLRMGTDRGWSRSVREKVSRVGVEKRRIWRVITKAPTQLVSGCAYARHESCLKLSPTYFRMTRVVLVWRHFGDDLERKLSLGSLGITWKKHCYFGLPRNPHNSSNQASGSGSNITIDDIVKSLAMSTQTFQQETKATIKNLENQISQLATSMSKMESQGKLPSQTEKNPNHKACAIT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G137390`
TK1151 ID	TkA04G137390
OH-1004 ID	LXL04_005017
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	41.000
Protein coverage (%)	TK1151 57.667 / OH-1004 42.612 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G137390

Location Chr04:35681107-35687302 (-)

Description Similar to pol: Retrovirus-related Pol polyprotein from transposon 17.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22400`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release
`At3g11490`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	RopGAP4-dependent Rop GTPase rheostat control of Arabidopsis oxygen deprivation tolerance.2002 · DOI: 10.1126/science.1071505
`At1g08340`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005017 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0075523 viral translational frameshifting Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0042575 DNA polymerase complex Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003887 DNA-directed DNA polymerase activity Molecular Function

KEGG gene cross-reference

sce:YGR109W-B

sce:YIL082W-A

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.584

Rank 1 · TkA04G137390 · TK1151

Nucleus0.399

Rank 2 · TkA04G137390 · TK1151

Cell membrane0.077

Rank 3 · TkA04G137390 · TK1151

Endoplasmic reticulum0.068

Rank 4 · TkA04G137390 · TK1151

Mitochondrion0.056

Rank 5 · TkA04G137390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13600DUF4140177-241 aa

PF16888YwqH-like183-239 aa

PF05443ROS_MUCR201-267 aa

PF23780S-AdoMet_lyase203-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G137390	`PF13600`	DUF4140	177	241	0.0066	17.6
TkA04G137390	`PF16888`	YwqH-like	183	239	0.0025	18.8
TkA04G137390	`PF05443`	ROS_MUCR	201	267	0.3	11.9
TkA04G137390	`PF23780`	S-AdoMet_lyase	203	269	0.13	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMR1`	Arabidopsis thaliana	sp\|Q9FMR1\|RGAP1_ARATH Rho GTPase-activating protein 1	65.900%	Swiss-Prot	Low
`Q9CAX8`	Arabidopsis thaliana	sp\|Q9CAX8\|RGAP4_ARATH Rho GTPase-activating protein 4	63.400%	Swiss-Prot	Low
`Q6NKT5`	Arabidopsis thaliana	sp\|Q6NKT5\|RGAP5_ARATH Rho GTPase-activating protein 5	53.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card