TkA04G132210 | RubberDandelionOmics

Gene overview

TkA04G132210

Reference: TK1151 Chr: Chr04 Coordinates: 34404473-34411069 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2382 bp · TkA04G132210|TK1151|cDNA

CAAGGGTCAATAGAGTTGATAAATCGATGAAAGACAACCTATGACATATCCAACATGTTAGATGTCATTACAAACGTAAAAGTGGATCACTATTTATTGCCATCGTTCTCCTTACATAAATGCAACGTCGGCACAGACCGCATCGGAGATGAAACTGGTGTGCGTAACACCACCTACCCTTCACCGCAGGAATGGAAGCTTTGGCGGAGGTCAAGGCGGAGGAGTGAAGTTACGGACTATTACCGGTGATCTCTTTCACT...

CDS

Download CDS FASTA

1170 bp · TkA04G132210|TK1151|CDS

ATGGGACACTCCGCCGTCGCCGGTGCTGATGTCCCGGTGAGAAATGCCGCGGATGAAGTTTCAAGAATCGTCGAACAAACTAAAGAGTTGCAGGACTCTGCAACATCTTTCACTTCTCGAACTTCGGAAGAGGAAGCATCACTCCGACAGCGAGCTCTAGCTCTTCGTTCCAACATCAAAATGCTCCGATTATTCATCGCTTCTTCCCTCAAGAAAGGCAATTTAGATCCCAAGAATGCTGCCAAAATGATTGAAGAGTT...

Protein

Download Protein FASTA

390 aa · TkA04G132210|TK1151|PROTEIN

MGHSAVAGADVPVRNAADEVSRIVEQTKELQDSATSFTSRTSEEEASLRQRALALRSNIKMLRLFIASSLKKGNLDPKNAAKMIEELTRVNFTLNEGDAAAYLPCKSHGRFLRMLLGPINVRANRKDVQLKVKEEYNNFRDTTAYLFLLFPSLLLVLRTWMWNGCFPALPVQLYQAWLLFLYTGLSFRENILRVNGSDIRPWWIYHHYCAMTMALISLTWEIEREPDCAGKQKGIQLFLKWAIMQGIAMLLQNKYQRQRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G132210`
TK1151 ID	TkA04G132210
OH-1004 ID	LXL04_035421
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.700
Protein coverage (%)	TK1151 91.026 / OH-1004 98.450 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G132210`
Location	Chr04:34404473-34411069 (+)
Description	Similar to tmem120: Transmembrane protein 120 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035421` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0045089 positive regulation of innate immune response Biological Process GO:0050829 defense response to Gram-negative bacterium Biological Process GO:0051291 protein heterooligomerization Biological Process GO:0005637 nuclear inner membrane Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	bta:508790 ddi:DDB_G0288699 dme:Dmel_CG32795 hsa:144404 mmu:330189 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.536

Rank 1 · TkA04G132210 · TK1151

Golgi apparatus0.277

Rank 2 · TkA04G132210 · TK1151

Cell membrane0.207

Rank 3 · TkA04G132210 · TK1151

Cytoplasm0.138

Rank 4 · TkA04G132210 · TK1151

Nucleus0.078

Rank 5 · TkA04G132210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19717DUF62129-109 aa

PF07851TMEM120A-B18-349 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G132210	`PF19717`	DUF6212	9	109	0.14	11.8
TkA04G132210	`PF07851`	TMEM120A-B	18	349	1.1e-92	311.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card