TkA04G131590 | RubberDandelionOmics

Gene overview

TkA04G131590

Reference: TK1151 Chr: Chr04 Coordinates: 34278445-34280166 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

927 bp · TkA04G131590|TK1151|cDNA

TATTGCCCCACCCACCATGGAATATTATATATAGACTGTTGCGAGCACACAACACACCTACCTTTTTTGCTTCTCGATTTTACTCCGCTCTCTTCTCTCTCTTTTGCATCTACCCTCTTCGCCTACTGTCCACTCTCCCTTTCTCTCTCTCCATCGGAAAACGTTTATTGTATGGCCGCCAATCACCAAAGCAGGGGAATCGCAAGTTTGGGGAAGCGATTTGTCAGTCAGATCCGAAGCTCATCTGCTCGTGATCCATC...

CDS

Download CDS FASTA

537 bp · TkA04G131590|TK1151|CDS

TATTGCCCCACCCACCATGGAATATTATATATAGACTGTTGCGAGCACACAACACACCTACCTTTTTTGCTTCTCGATTTTACTCCGCTCTCTTCTCTCTCTTTTGCATCTACCCTCTTCGCCTACTGTCCACTCTCCCTTTCTCTCTCTCCATCGGAAAACGTTTATTGTATGGCCGCCAATCACCAAAGCAGGGGAATCGCAAGTTTGGGGAAGCGATTTGTCAGTCAGATCCGAAGCTCATCTGCTCGTGATCCATC...

Protein

Download Protein FASTA

178 aa · TkA04G131590|TK1151|PROTEIN

YCPTHHGILYIDCCEHTTHLPFLLLDFTPLSSLSFASTLFAYCPLSLSLSPSENVYCMAANHQSRGIASLGKRFVSQIRSSSARDPSLILRRAVHVSVYDKNIDDQVRPTLVPDEAITRKESEQYWAPHPKTGVFGPSVDEPNSGSGGASGAAGADGSVLEEKAFFRPSENLEKPAHA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G131590`
TK1151 ID	TkA04G131590
OH-1004 ID	LXL04_035429
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 87.640 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G131590

Location Chr04:34278445-34280166 (+)

Description Similar to At5g17165: Late embryogenesis abundant protein At5g17165

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17165`	Late embryogenesis abundant protein At5g17165.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035429 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT5G17165

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.644

Rank 1 · TkA04G131590 · TK1151

Plastid0.204

Rank 2 · TkA04G131590 · TK1151

Nucleus0.139

Rank 3 · TkA04G131590 · TK1151

Cytoplasm0.113

Rank 4 · TkA04G131590 · TK1151

Cell membrane0.030

Rank 5 · TkA04G131590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03242LEA_3a32-81 aa

PF22272LEA_3b92-175 aa

PF03242LEA_3a115-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G131590	`PF03242`	LEA_3a	32	81	0.00084	20.5
TkA04G131590	`PF22272`	LEA_3b	92	175	1e-28	100.3
TkA04G131590	`PF03242`	LEA_3a	115	138	0.00084	20.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KFM8`	Arabidopsis thaliana	sp\|F4KFM8\|LEA65_ARATH Late embryogenesis abundant protein At5g17165	39.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card