TkA04G131240 | RubberDandelionOmics

Gene overview

TkA04G131240

Reference: TK1151 Chr: Chr04 Coordinates: 34207655-34214817 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1259 bp · TkA04G131240|TK1151|cDNA

TTTGTATCTGAAATAGAAAAAAAACCTCCTTGAGCATTGAAAGTGCTACCAAACAAACACGAGAACCCTAATCCAAAATTCAGAATGTAAGAGAATAAAGTAAACAAAAAATCGTAATTGTGACCTTCGTATGCAATTTTGCGCCAGTAGGAAGATTCTCTGAAGCAACGCTACCATCAATTATTCCATCTTTTCTTTTGACAATTATCGTTTGTTTTTTGGTCTAATTGTTGTTTTTCCTTTTATATCTACCGCGATCC...

CDS

Download CDS FASTA

567 bp · TkA04G131240|TK1151|CDS

ATGGGACAGGTTTTTCGTAAGCTCTTCGATGCATTCTTCGGCAACAGCGAGATGCGGGTTGTCATGCTAGGGCTTGATGCAGCAGGGAAAACAACCATACTGTACAAGCTGCATATTGGAGAAGTTCTATCAACTGTCCCTACTATTGGTTTCAATGTGGAAAAAGTTCAGTACAAGAATGTGATGTTCACGGTTTGGGATGTTGGTGGCCAAGAAAAGCTGCGGCCCTTGTGGAGGCATTACTTCAATGACACAAATGG...

Protein

Download Protein FASTA

188 aa · TkA04G131240|TK1151|PROTEIN

MGQVFRKLFDAFFGNSEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKNVMFTVWDVGGQEKLRPLWRHYFNDTNGLIYVVDSLDRERIGRAKAEFQAIINDPFMTNCVILVFANKQDMKGAMTAMEVCEGLGMYELKNRKWHIQGTCALRGDGLYEGLDWLASTLKDMKAASSSSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G131240`
TK1151 ID	TkA04G131240
OH-1004 ID	LXL04_035432
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 84.043 / OH-1004 45.533 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G131240`
Location	Chr04:34207655-34214817 (+)
Description	Similar to ADP-ribosylation factor
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035432` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006886 intracellular protein transport Biological Process GO:0007005 mitochondrion organization Biological Process GO:0007276 gamete generation Biological Process GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0048259 regulation of receptor-mediated endocytosis Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005886 plasma membrane Cellular Component GO:0003924 GTPase activity Molecular Function
KEGG gene cross-reference	cbr:CBG_09004 cel:CELE_B0336.2 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.528

Rank 1 · TkA04G131240 · TK1151

Cytoplasm0.382

Rank 2 · TkA04G131240 · TK1151

Endoplasmic reticulum0.200

Rank 3 · TkA04G131240 · TK1151

Cell membrane0.149

Rank 4 · TkA04G131240 · TK1151

Lysosome / Vacuole0.115

Rank 5 · TkA04G131240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025Arf6-176 aa

PF015916PF2K15-58 aa

PF00503G-alpha16-39 aa

PF09439SRPRB16-139 aa

PF08477Roc19-129 aa

PF00071Ras19-132 aa

PF01926MMR_HSR119-116 aa

PF04670Gtr1_RagA20-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G131240	`PF00025`	Arf	6	176	1.7e-71	240.0
TkA04G131240	`PF01591`	6PF2K	15	58	0.0028	17.7
TkA04G131240	`PF00503`	G-alpha	16	39	6.3e-14	52.6
TkA04G131240	`PF09439`	SRPRB	16	139	3.5e-11	43.5
TkA04G131240	`PF08477`	Roc	19	129	7.3e-13	49.5
TkA04G131240	`PF00071`	Ras	19	132	2.8e-11	44.0
TkA04G131240	`PF01926`	MMR_HSR1	19	116	0.012	16.4
TkA04G131240	`PF04670`	Gtr1_RagA	20	131	5.3e-08	33.3
TkA04G131240	`PF00503`	G-alpha	44	130	6.3e-14	52.6
TkA04G131240	`PF01591`	6PF2K	79	103	0.0028	17.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card