TkA04G129320 | RubberDandelionOmics

Gene overview

TkA04G129320

Reference: TK1151 Chr: Chr04 Coordinates: 33656280-33661229 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4099 bp · TkA04G129320|TK1151|cDNA

AAATAAAGAGTGGAATAATAGGGAGGGGTTTTAAACGGGGTTTTTTATACATCATCTTCACTGTAAAAGAGTGGAAGAAAACAGAGGAAGGTGGAATTTTACTACTGGCGTTTTTCTTGCCCGTATGAAAAGAGGAGCACAAAGTAGATAAACTAAAAAACAAATCCCATTCGACTCGTACGACTACACCTTCCAATTGACTCCACCACCCTTTTCACATCTTCTTTATCATCAGATCTATTTGCTCTCTCTTCCAGATC...

CDS

Download CDS FASTA

3120 bp · TkA04G129320|TK1151|CDS

ATGGAAGAGGTTGGTACTCAGCTAGCTCCTCCGTTATATATGTACAACTCAATCGGTGCCGGAAGATTCCCCGATACCCATCCGATGGCCAAGAAACGAAGCCTGCCGTATCAAAACTCAAACTTTATTCAACATCAGCAACAGCAACAGTATCTACAAAGGTTAATCCCAAGTTTAAACGAGCCTAGGAACAGTTGGAACCCTAAAAATTGGGAATGGGACAGTTCACGACTCGTGGCTAAACCCTTGGATATGATGGA...

Protein

Download Protein FASTA

1039 aa · TkA04G129320|TK1151|PROTEIN

MEEVGTQLAPPLYMYNSIGAGRFPDTHPMAKKRSLPYQNSNFIQHQQQQQYLQRLIPSLNEPRNSWNPKNWEWDSSRLVAKPLDMMEISQEQEQQHQQQHHQTAINPPNPDVSKKSPGGQREEDERLLLKLGGGEEPATRPSKRVRSGSPGTGCAGNYPMCQVDNCKEDLSTAKDYHRRHKVCEVHSKAGKALVGKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQPEDVASQLLLPGNNDKNGAKEMNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G129320`
TK1151 ID	TkA04G129320
OH-1004 ID	LXL04_035460
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G129320

Location Chr04:33656280-33661229 (+)

Description Similar to SPL14: Squamosa promoter-binding-like protein 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20980`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity).	Arabidopsis AtSPL14, a plant-specific SBP-domain transcription factor, participates in plant development and sensitivity to fumonisin B1.2005 · DOI: 10.1111/j.1365-313x.2005.02334.x
`At1g76580`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release
`At3g60030`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	An Arabidopsis SBP-domain fragment with a disrupted C-terminal zinc-binding site retains its tertiary structure.2006 · DOI: 10.1016/j.febslet.2006.03.014

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YX04`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release
`Os08g0513700`	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035460 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G20980

ath:AT3G60030

dosa:Os08g0513700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.629

Rank 1 · TkA04G129320 · TK1151

Cytoplasm0.315

Rank 2 · TkA04G129320 · TK1151

Cell membrane0.091

Rank 3 · TkA04G129320 · TK1151

Mitochondrion0.053

Rank 4 · TkA04G129320 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA04G129320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03110SBP161-234 aa

PF26102Ig_SPL7644-746 aa

PF00023Ank833-847 aa

PF00023Ank870-891 aa

PF00023Ank1012-1021 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G129320	`PF03110`	SBP	161	234	7e-31	107.1
TkA04G129320	`PF26102`	Ig_SPL7	644	746	1.3e-29	103.3
TkA04G129320	`PF00023`	Ank	833	847	0.17	13.0
TkA04G129320	`PF00023`	Ank	870	891	0.17	13.0
TkA04G129320	`PF00023`	Ank	1012	1021	0.17	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY95`	Arabidopsis thaliana	sp\|Q8RY95\|SPL14_ARATH Squamosa promoter-binding-like protein 14	47.000%	Swiss-Prot	Medium
`Q700C2`	Arabidopsis thaliana	sp\|Q700C2\|SPL16_ARATH Squamosa promoter-binding-like protein 16	46.400%	Swiss-Prot	Medium
`Q9S7P5`	Arabidopsis thaliana	sp\|Q9S7P5\|SPL12_ARATH Squamosa promoter-binding-like protein 12	33.700%	Swiss-Prot	Medium
`A2YX04`	Oryza sativa subsp. indica	sp\|A2YX04\|SPL15_ORYSI Squamosa promoter-binding-like protein 15	40.700%	Swiss-Prot	Medium
`Q6Z8M8`	Oryza sativa subsp. japonica	sp\|Q6Z8M8\|SPL15_ORYSJ Squamosa promoter-binding-like protein 15	40.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card