RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G127120
Reference: TK1151 Chr: Chr04 Coordinates: 33009380-33013388 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2968 bp · TkA04G127120|TK1151|cDNA

TGGTTGACAAAATATTTTAACTCCAACATAATCAATATTAGGACTAAACTTTTAATTAAGATTAAACCAAATTAAATACCGTCAAATAAATTAGTAATATTTGTATAGTTCAATCCTAAATAAATGATATAGCCAACCCTAGTTCGTCGATTTCTGAATTGGATATTCCCTCATCTACTATTGTTGGTGAATATATGTATTCCGTTTGCGTGTTCATATTGAGTACTCCATCTGTTCCATATAAGATTTCAGTTTTTAAG...

CDS

Download CDS FASTA

453 bp · TkA04G127120|TK1151|CDS

ATGTGCTACGTTACCGCATCGATTAAGAATGAGTGGCCTACCGCTAACAAGTTCAGTTCCATCGTCAAAGCTCAACCTTATAGAAATAGATGTGGTTTGAGTAGGAGAGATTTTGCTACGAAAGGAATTGTTGTAGCTGGTGCTTTGGTGATGCCGTCTACTTTGCTATCTCAATCTGCTCAAGGCTTAGAGAGACTGCCTTTCAAAAAAGATGGATATAACTTTTGGACATGGAGAGGTCACAAATACATTACGTTGAA...

Protein

Download Protein FASTA

150 aa · TkA04G127120|TK1151|PROTEIN

MCYVTASIKNEWPTANKFSSIVKAQPYRNRCGLSRRDFATKGIVVAGALVMPSTLLSQSAQGLERLPFKKDGYNFWTWRGHKYITLKKKKVSPLFLFMVLVLQLSIGGTIYLNWLKRTKCMLWTYSALGGVKRHLLIMMLWCGEIKLLIS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G127120
TK1151 IDTkA04G127120
OH-1004 IDLXL04_038031
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)93.300
Protein coverage (%)TK1151 50.000 / OH-1004 40.984
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G127120
LocationChr04:33009380-33013388 (-)
DescriptionSimilar to dmpD: 2-hydroxymuconate semialdehyde hydrolase (Pseudomonas sp. (strain CF600)
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038031 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009636 response to toxic substance Biological Process
GO:0010628 positive regulation of gene expression Biological Process
GO:0016311 dephosphorylation Biological Process
GO:0042632 cholesterol homeostasis Biological Process
GO:0043640 benzoate catabolic process via hydroxylation Biological Process
GO:0043651 linoleic acid metabolic process Biological Process
GO:0045777 positive regulation of blood pressure Biological Process
GO:0046272 stilbene catabolic process Biological Process
GO:0046464 acylglycerol catabolic process Biological Process
GO:0046839 phospholipid dephosphorylation Biological Process
GO:0090181 regulation of cholesterol metabolic process Biological Process
GO:0097176 epoxide metabolic process Biological Process
KEGG gene cross-reference
ag:CAA36993
mbo:BQ2027_MB2734
pau:PA14_26090
rno:65030
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.913
Rank 1 · TkA04G127120 · TK1151
Mitochondrion0.078
Rank 2 · TkA04G127120 · TK1151
Nucleus0.030
Rank 3 · TkA04G127120 · TK1151
Cytoplasm0.026
Rank 4 · TkA04G127120 · TK1151
Cell membrane0.015
Rank 5 · TkA04G127120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser