TkA04G125710 | RubberDandelionOmics

Gene overview

TkA04G125710

Reference: TK1151 Chr: Chr04 Coordinates: 32660029-32662692 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1185 bp · TkA04G125710|TK1151|cDNA

TGTACGAGTGTCCTCCACATTCATTTTTTAAAATCCATATCCTGTACCAAAAACCATCTCCACCAGGACACTGCCCTGTCCTGCCCTTATTCTATGAGCCCCCGCTGAACTCTCTTGGCTTTTATCCCTTTATCTAAAGGTTAAAGTCGTAATAATGTCAGAGAGTCAGACGGGTAATGGAGCTCACACTCTTCACTCCCATGGCAAAGTACTCGCAAGAGAGCATATACATGATTGGTTGGTTCTTTTGCTCTTAGTAT...

CDS

Download CDS FASTA

846 bp · TkA04G125710|TK1151|CDS

ATGTCAGAGAGTCAGACGGGTAATGGAGCTCACACTCTTCACTCCCATGGCAAAGTACTCGCAAGAGAGCATATACATGATTGGTTGGTTCTTTTGCTCTTAGTATCACTCGAATTGTTCTTAAACCTTATCGAGCCTTTCCATCGCTATGTCGGGGAAGAAATGATGATTGAGATGAAATATCCGTTTTACCAAAAGGACACCATTCCTATGTATGCAGTTCCGGTATATGTAGGGGTATTACCGTGTATGGTATTCCT...

Protein

Download Protein FASTA

281 aa · TkA04G125710|TK1151|PROTEIN

MSESQTGNGAHTLHSHGKVLAREHIHDWLVLLLLVSLELFLNLIEPFHRYVGEEMMIEMKYPFYQKDTIPMYAVPVYVGVLPCMVFLMYYMRRRDVYDLHHAVLGLFYSVLITAVITDSIKDATGRPRPNFFYRCFPDGKAEFGADGDVKCHGDKMIIKEGYKSFPSGHTSWSFAGLGFLSWYLCGKLRAFDNKGHAANLCIVVSPYLFAALVGVSRVDDYWHHWTDVFTGAVIGTVVAAFCYLQFFPFPHHENGWAPHA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G125710`
TK1151 ID	TkA04G125710
OH-1004 ID	LXL04_035516
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 73.310 / OH-1004 68.896 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G125710

Location Chr04:32660029-32662692 (+)

Description Similar to LPP3: Putative lipid phosphate phosphatase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02600`	Putative lipid phosphate phosphatase 3, chloroplastic.	No verified direct reference in this release
`At3g18220`	Probable lipid phosphate phosphatase 4.	No verified direct reference in this release
`At1g15080`	May play a general 'housekeeping role' in lipid metabolism.	Lipid phosphate phosphatases in Arabidopsis. Regulation of the AtLPP1 gene in response to stress.2001 · DOI: 10.1074/jbc.m009726200 An important role of phosphatidic acid in ABA signaling during germination in Arabidopsis thaliana.2005 · DOI: 10.1111/j.1365-313x.2005.02431.x Arabidopsis thaliana lipid phosphate phosphatase 2 is involved in abscisic acid signalling in leaves.2011 · DOI: 10.1016/j.plaphy.2011.01.010
`At2g01180`	Plays a general role in cellular responses to stress, may be by attenuating the signal produced by phospholipases.	Lipid phosphate phosphatases in Arabidopsis. Regulation of the AtLPP1 gene in response to stress.2001 · DOI: 10.1074/jbc.m009726200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035516 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006644 phospholipid metabolic process Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010224 response to UV-B Biological Process

GO:0046839 phospholipid dephosphorylation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0000810 diacylglycerol diphosphate phosphatase activity Molecular Function

GO:0003993 acid phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G15080

ath:AT2G01180

ath:AT3G02600

ath:AT3G18220

mmu:71910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.383

Rank 1 · TkA04G125710 · TK1151

Lysosome / Vacuole0.201

Rank 2 · TkA04G125710 · TK1151

Cytoplasm0.198

Rank 3 · TkA04G125710 · TK1151

Golgi apparatus0.186

Rank 4 · TkA04G125710 · TK1151

Endoplasmic reticulum0.182

Rank 5 · TkA04G125710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04246RseC_MucC49-122 aa

PF05078DUF67971-95 aa

PF01569PAP284-94 aa

PF05078DUF679101-126 aa

PF01569PAP2103-247 aa

PF05078DUF679201-232 aa

PF04246RseC_MucC230-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G125710	`PF04246`	RseC_MucC	49	122	0.44	11.2
TkA04G125710	`PF05078`	DUF679	71	95	0.1	13.2
TkA04G125710	`PF01569`	PAP2	84	94	1.3e-29	103.2
TkA04G125710	`PF05078`	DUF679	101	126	0.1	13.2
TkA04G125710	`PF01569`	PAP2	103	247	1.3e-29	103.2
TkA04G125710	`PF05078`	DUF679	201	232	0.1	13.2
TkA04G125710	`PF04246`	RseC_MucC	230	237	0.44	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LFD1`	Arabidopsis thaliana	sp\|Q8LFD1\|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic	62.200%	Swiss-Prot	High
`Q0WNG6`	Arabidopsis thaliana	sp\|Q0WNG6\|LPP4_ARATH Probable lipid phosphate phosphatase 4	62.600%	Swiss-Prot	High
`Q9XI60`	Arabidopsis thaliana	sp\|Q9XI60\|LPP2_ARATH Lipid phosphate phosphatase 2	63.900%	Swiss-Prot	High
`Q9ZU49`	Arabidopsis thaliana	sp\|Q9ZU49\|LPP1_ARATH Lipid phosphate phosphatase 1	62.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card