TkA04G124350 | RubberDandelionOmics

Gene overview

TkA04G124350

Reference: TK1151 Chr: Chr04 Coordinates: 32311990-32316729 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3316 bp · TkA04G124350|TK1151|cDNA

TTGACCCCTTTTGCGGTTTTGCCATCGTCGCATCTGAGCATACAACCTCCCCTCTCCTCCATCGGTGGTACTTCCCGGCGCCGTCTTACTCCATCGACGGCAGCGTCCTGCGACGCTTCTCCTCGGGGATACCATGAAGCTATCTTTTTCTCTTTCATCAAAACCCCCAAAACCTACTCTAAAACCATCGCAGGATCAACCATCATCGTCTGCGAAAAAAGAGTTCCTCACGGAGTTCGACCCATCCAAACCCGTAACCG...

CDS

Download CDS FASTA

1182 bp · TkA04G124350|TK1151|CDS

ATGAAGCTATCTTTTTCTCTTTCATCAAAACCCCCAAAACCTACTCTAAAACCATCGCAGGATCAACCATCATCGTCTGCGAAAAAAGAGTTCCTCACGGAGTTCGACCCATCCAAACCCGTAACCGATCCCAATTCCAAAAACTCTTTTGTTATCGCTCCAATTTCCAACGAATGGAGACCTCAAAAAAAGATGAGAAACCTCGATCTCCCCGTCAAATCCGACGACCCCAACCTCCAATTCGAAGTCATGAACAACAC...

Protein

Download Protein FASTA

393 aa · TkA04G124350|TK1151|PROTEIN

MKLSFSLSSKPPKPTLKPSQDQPSSSAKKEFLTEFDPSKPVTDPNSKNSFVIAPISNEWRPQKKMRNLDLPVKSDDPNLQFEVMNNTVEQTDPNITYGLNLRSKKDPSPDSNNPKPDRLQSTSIDNLMLNKLRNDLERLPEDRGMEEFEDISVENFASALLKGYGWVEGRGIGKNAKEDVKVVEYKKRTGKEGLGFVNDIPIPPTKKETNERKESGNGSGSGGDGRRGRSKEEVKVRHGGERRSKDRSHSKRSQSHERQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G124350`
TK1151 ID	TkA04G124350
OH-1004 ID	LXL04_035546
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 99.746 / OH-1004 75.530 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G124350

Location Chr04:32311990-32316729 (+)

Description Similar to MOS2: Protein MOS2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g33520`	Required for innate and induced resistance to pathogens such as compatible and incompatible isolates of P.syringae and P.parasitica.	MOS2, a protein containing G-patch and KOW motifs, is essential for innate immunity in Arabidopsis thaliana.2005 · DOI: 10.1016/j.cub.2005.09.038

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035546 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1900056 negative regulation of leaf senescence Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005681 spliceosomal complex Cellular Component

KEGG gene cross-reference

ath:AT1G33520

ath:AT4G19040

ath:AT5G45560

dre:368735

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.967

Rank 1 · TkA04G124350 · TK1151

Cytoplasm0.169

Rank 2 · TkA04G124350 · TK1151

Mitochondrion0.016

Rank 3 · TkA04G124350 · TK1151

Cell membrane0.010

Rank 4 · TkA04G124350 · TK1151

Endoplasmic reticulum0.005

Rank 5 · TkA04G124350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12230PRP21_like_P46-67 aa

PF12656G-patch_2140-197 aa

PF01585G-patch154-195 aa

PF12230PRP21_like_P205-284 aa

PF23287KOW7_SPT5230-242 aa

PF18131KN17_SH3273-319 aa

PF25088GPKOW_C279-386 aa

PF23287KOW7_SPT5333-366 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G124350	`PF12230`	PRP21_like_P	46	67	0.15	12.6
TkA04G124350	`PF12656`	G-patch_2	140	197	4.1e-19	69.1
TkA04G124350	`PF01585`	G-patch	154	195	8.5e-06	26.3
TkA04G124350	`PF12230`	PRP21_like_P	205	284	0.15	12.6
TkA04G124350	`PF23287`	KOW7_SPT5	230	242	0.31	11.6
TkA04G124350	`PF18131`	KN17_SH3	273	319	0.00083	20.0
TkA04G124350	`PF25088`	GPKOW_C	279	386	4.8e-38	130.3
TkA04G124350	`PF23287`	KOW7_SPT5	333	366	0.31	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C801`	Arabidopsis thaliana	sp\|Q9C801\|MOS2_ARATH Protein MOS2	43.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card