TkA04G122970 | RubberDandelionOmics

Gene overview

TkA04G122970

Reference: TK1151 Chr: Chr04 Coordinates: 31968609-31968990 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

309 bp · TkA04G122970|TK1151|cDNA

ATGAAGTGGATACTGCATGATTGGAGCGACGATCTTTGTGAAAAGTTGCTAAAGAATTGCTACAAGGCTCTTCCGAATGAAGGGAAGCTTATTGTAGTCGAGTCTATTCTTCCTCTTCTTTCTGACACAAGCTCTTCCGACAAAGCCACCGCACAATTAGATGCATCCATGATGACACAAAATCCCGGAGGAAAGGAGCGCACAGAGGAAGAGTTTCTTTACTTGGCTAGAAGTAGAAGTGCAGGATTCACTGGAATAAA...

CDS

Download CDS FASTA

309 bp · TkA04G122970|TK1151|CDS

ATGAAGTGGATACTGCATGATTGGAGCGACGATCTTTGTGAAAAGTTGCTAAAGAATTGCTACAAGGCTCTTCCGAATGAAGGGAAGCTTATTGTAGTCGAGTCTATTCTTCCTCTTCTTTCTGACACAAGCTCTTCCGACAAAGCCACCGCACAATTAGATGCATCCATGATGACACAAAATCCCGGAGGAAAGGAGCGCACAGAGGAAGAGTTTCTTTACTTGGCTAGAAGTAGAAGTGCAGGATTCACTGGAATAAA...

Protein

Download Protein FASTA

102 aa · TkA04G122970|TK1151|PROTEIN

MKWILHDWSDDLCEKLLKNCYKALPNEGKLIVVESILPLLSDTSSSDKATAQLDASMMTQNPGGKERTEEEFLYLARSRSAGFTGIKMECFVCNLWVMEFYK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G122970`
TK1151 ID	TkA04G122970
OH-1004 ID	LXL04_035568
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.100
Protein coverage (%)	TK1151 100.000 / OH-1004 57.803 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G122970`
Location	Chr04:31968609-31968990 (-)
Description	Similar to COMT: Caffeic acid 3-O-methyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035568` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009699 phenylpropanoid biosynthetic process Biological Process GO:0009809 lignin biosynthetic process Biological Process GO:0009813 flavonoid biosynthetic process Biological Process GO:0009820 alkaloid metabolic process Biological Process GO:0032259 methylation Biological Process GO:0008171 O-methyltransferase activity Molecular Function GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function GO:0046983 protein dimerization activity Molecular Function GO:0047763 caffeate O-methyltransferase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.504

Rank 1 · TkA04G122970 · TK1151

Extracellular0.190

Rank 2 · TkA04G122970 · TK1151

Nucleus0.150

Rank 3 · TkA04G122970 · TK1151

Peroxisome0.069

Rank 4 · TkA04G122970 · TK1151

Mitochondrion0.042

Rank 5 · TkA04G122970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00891Methyltransf_21-83 aa

PF06859Bin32-32 aa

PF08812YtxC2-50 aa

PF24101WHD_GTF3C19-62 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G122970	`PF00891`	Methyltransf_2	1	83	5.5e-21	75.6
TkA04G122970	`PF06859`	Bin3	2	32	0.2	12.9
TkA04G122970	`PF08812`	YtxC	2	50	0.21	11.8
TkA04G122970	`PF24101`	WHD_GTF3C1	9	62	0.22	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card