TkA04G122760 | RubberDandelionOmics

Gene overview

TkA04G122760

Reference: TK1151 Chr: Chr04 Coordinates: 31899196-31904044 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1848 bp · TkA04G122760|TK1151|cDNA

CTATGGTGATATTTTTTTTTTGCAGTTCCAAGGACTATTTATGTAATTATGTATTTCTTATTTTTATTTAGAACGCGTATATTTGGGTCGATTGAGCTCTGTCTTGTTTCGGATTTTCCCTGAGAACCGAACTACCAAAACCCTAAGCAGTACGTGTTTGAAGGTTCTTGAAATGGATGCAATACGAAAGCAGCTAGATGTGCTGATGGGAGCTAATCGGAATGGAGATGTCAGAGAAGTCAATCGGAAGTACTACGATC...

CDS

Download CDS FASTA

1266 bp · TkA04G122760|TK1151|CDS

ATGGATGCAATACGAAAGCAGCTAGATGTGCTGATGGGAGCTAATCGGAATGGAGATGTCAGAGAAGTCAATCGGAAGTACTACGATCGTGATGTCTGCCGTCTCTTCTTGGTCGGCCTTTGCCCTCATGAACTGTTTCAACTCACCAAAATGGACATGGGACCATGCCCGAAGGTGCACTCATTTCAGCTAAGGAAAGAATACCAAGAAGCTAAGGCAAAAGGTCAAGACAATTATGATAGGGAATTGGAAGATGTTAT...

Protein

Download Protein FASTA

421 aa · TkA04G122760|TK1151|PROTEIN

MDAIRKQLDVLMGANRNGDVREVNRKYYDRDVCRLFLVGLCPHELFQLTKMDMGPCPKVHSFQLRKEYQEAKAKGQDNYDRELEDVIDRLIVECDRKIARALKRLSEEDAKAAIAISVSEVTQTPEILELSKQIKEKLKEADQNDLEGKADMKIRALEMVEELRTQRADKQSMLLLDAFNKDRASLPQPLPNPPPLAPLPVGTPDARTQELINEKLKKAEDLGEQGMLDEAQKALEEAEALKKLSMHLPPRQEPVTDSSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G122760`
TK1151 ID	TkA04G122760
OH-1004 ID	LXL04_035571
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 74.822 / OH-1004 69.079 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G122760`
Location	Chr04:31899196-31904044 (-)
Description	Similar to crop: Luc7-like protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035571` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006376 mRNA splice site recognition Biological Process GO:0008380 RNA splicing Biological Process GO:0005634 nucleus Cellular Component GO:0005685 U1 snRNP Cellular Component GO:0071004 U2-type prespliceosome Cellular Component GO:0071011 precatalytic spliceosome Cellular Component GO:0003729 mRNA binding Molecular Function GO:0042802 identical protein binding Molecular Function GO:0050733 RS domain binding Molecular Function
KEGG gene cross-reference	ddi:DDB_G0278799 dme:Dmel_CG7564 hsa:55692 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.753

Rank 1 · TkA04G122760 · TK1151

Cytoplasm0.343

Rank 2 · TkA04G122760 · TK1151

Cell membrane0.036

Rank 3 · TkA04G122760 · TK1151

Mitochondrion0.029

Rank 4 · TkA04G122760 · TK1151

Endoplasmic reticulum0.024

Rank 5 · TkA04G122760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03194LUC72-171 aa

PF18360hnRNP_Q_AcD94-114 aa

PF15781ParE-like_toxin95-128 aa

PF18360hnRNP_Q_AcD129-168 aa

PF22360SbsC_spectrin-like152-158 aa

PF03194LUC7208-331 aa

PF22360SbsC_spectrin-like215-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G122760	`PF03194`	LUC7	2	171	1.9e-70	238.2
TkA04G122760	`PF18360`	hnRNP_Q_AcD	94	114	0.44	11.4
TkA04G122760	`PF15781`	ParE-like_toxin	95	128	0.19	12.4
TkA04G122760	`PF18360`	hnRNP_Q_AcD	129	168	0.44	11.4
TkA04G122760	`PF22360`	SbsC_spectrin-like	152	158	0.15	13.5
TkA04G122760	`PF03194`	LUC7	208	331	1.9e-70	238.2
TkA04G122760	`PF22360`	SbsC_spectrin-like	215	245	0.15	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card