RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G122520
Reference: TK1151 Chr: Chr04 Coordinates: 31824573-31825890 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

591 bp · TkA04G122520|TK1151|cDNA

TTTATTCCTAGTGTTTATGGTTTAGATAGCTTTACGGGGTCGATCATACACTCAAGTGAATACCAAAATGGAAAGATATTTGGGAACAAAAATGTTTTTGTTGTTGGTGCTGGCAATTCTGGAATGGAAATTGCTTATGATTTGTCCAACTGGGGTGCCCAAACATTCATCCTTGTTCGTAGCCCTGTAAGTTTTTTTATCAGTGGAGCTCTTTGTAAATATGGAATACAAAGACCAAGAAAAGGGCCATTTTGTCTTAA...

CDS

Download CDS FASTA

591 bp · TkA04G122520|TK1151|CDS

TTTATTCCTAGTGTTTATGGTTTAGATAGCTTTACGGGGTCGATCATACACTCAAGTGAATACCAAAATGGAAAGATATTTGGGAACAAAAATGTTTTTGTTGTTGGTGCTGGCAATTCTGGAATGGAAATTGCTTATGATTTGTCCAACTGGGGTGCCCAAACATTCATCCTTGTTCGTAGCCCTGTAAGTTTTTTTATCAGTGGAGCTCTTTGTAAATATGGAATACAAAGACCAAGAAAAGGGCCATTTTGTCTTAA...

Protein

Download Protein FASTA

196 aa · TkA04G122520|TK1151|PROTEIN

FIPSVYGLDSFTGSIIHSSEYQNGKIFGNKNVFVVGAGNSGMEIAYDLSNWGAQTFILVRSPVSFFISGALCKYGIQRPRKGPFCLKRETGPVIDVGTVARIKTGDIVVMSTIEEVKGDQIKFTDGQEKRYDGIVFATGFTSTVRKWLKDDRGLFNEKGMPYLKSPNHWKGEHGLILCWICKCWIVRNFEGCKEHC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G122520
TK1151 IDTkA04G122520
OH-1004 IDLXL04_035576
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)73.400
Protein coverage (%)TK1151 89.286 / OH-1004 54.331
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G122520
LocationChr04:31824573-31825890 (+)
DescriptionSimilar to YUC11: Probable indole-3-pyruvate monooxygenase YUCCA11
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g21430 Involved in auxin biosynthesis.
Auxin synthesized by the YUCCA flavin monooxygenases is essential for embryogenesis and leaf formation in Arabidopsis.2007 · DOI: 10.1105/tpc.107.053009
At1g48910 Involved in auxin biosynthesis.
Auxin synthesized by the YUCCA flavin monooxygenases is essential for embryogenesis and leaf formation in Arabidopsis.2007 · DOI: 10.1105/tpc.107.053009
At5g25620 Involved in auxin biosynthesis via the indole-3-pyruvic acid (IPA) pathway.
Auxin biosynthesis by the YUCCA flavin monooxygenases controls the formation of floral organs and vascular tissues in Arabidopsis.2006 · DOI: 10.1101/gad.1415106
yucca6, a dominant mutation in Arabidopsis, affects auxin accumulation and auxin-related phenotypes.2007 · DOI: 10.1104/pp.107.104935
Overexpression of Arabidopsis YUCCA6 in potato results in high-auxin developmental phenotypes and enhanced resistance to water deficit.2013 · DOI: 10.1093/mp/sss100
The biochemical mechanism of auxin biosynthesis by an arabidopsis YUCCA flavin-containing monooxygenase.2013 · DOI: 10.1074/jbc.m112.424077
At5g11320 Involved in auxin biosynthesis.
Auxin biosynthesis by the YUCCA flavin monooxygenases controls the formation of floral organs and vascular tissues in Arabidopsis.2006 · DOI: 10.1101/gad.1415106
Auxin synthesized by the YUCCA flavin monooxygenases is essential for embryogenesis and leaf formation in Arabidopsis.2007 · DOI: 10.1105/tpc.107.053009

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0224700 Involved in auxin biosynthesis in anthers.
OsFTIP7 determines auxin-mediated anther dehiscence in rice.2018 · DOI: 10.1038/s41477-018-0175-0
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035576 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006979 response to oxidative stress Biological Process
GO:0009635 response to herbicide Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009819 drought recovery Biological Process
GO:0009851 auxin biosynthetic process Biological Process
GO:0010038 response to metal ion Biological Process
GO:0010262 somatic embryogenesis Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005576 extracellular region Cellular Component
GO:0005654 nucleoplasm Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
KEGG gene cross-reference
ath:AT1G04180
ath:AT1G21430
ath:AT1G48910
ath:AT5G11320
ath:AT5G25620
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.328
Rank 1 · TkA04G122520 · TK1151
Peroxisome0.249
Rank 2 · TkA04G122520 · TK1151
Mitochondrion0.120
Rank 3 · TkA04G122520 · TK1151
Nucleus0.113
Rank 4 · TkA04G122520 · TK1151
Extracellular0.101
Rank 5 · TkA04G122520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00743FMO-like4-61 aa
PF13434Lys_Orn_oxgnase12-51 aa
PF13738Pyr_redox_315-163 aa
PF07992Pyr_redox_227-61 aa
PF01946Thi427-60 aa
PF01488Shikimate_DH28-58 aa
PF00899ThiF29-59 aa
PF00070Pyr_redox31-62 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G122520PF00743FMO-like4611.8e-1453.8
TkA04G122520PF13434Lys_Orn_oxgnase12511.4e-0525.2
TkA04G122520PF13738Pyr_redox_3151636.3e-1039.5
TkA04G122520PF07992Pyr_redox_227617.2e-0729.6
TkA04G122520PF01946Thi427600.1112.5
TkA04G122520PF01488Shikimate_DH28580.1812.6
TkA04G122520PF00899ThiF29590.1212.3
TkA04G122520PF00070Pyr_redox31626.1e-0524.2
TkA04G122520PF01134GIDA32600.008715.9
TkA04G122520PF01266DAO32600.1112.7
TkA04G122520PF00743FMO-like921421.8e-1453.8
TkA04G122520PF01488Shikimate_DH1011130.1812.6
TkA04G122520PF07992Pyr_redox_21071447.2e-0729.6
TkA04G122520PF01266DAO1131430.1112.7
TkA04G122520PF13434Lys_Orn_oxgnase1251411.4e-0525.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LPL3Arabidopsis thalianasp|Q9LPL3|YUC11_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1146.200%Swiss-ProtMedium
Q9FVQ0Arabidopsis thalianasp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1042.500%Swiss-ProtMedium
Q8VZ59Arabidopsis thalianasp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA645.100%Swiss-ProtMedium
Q9LFM5Arabidopsis thalianasp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA443.700%Swiss-ProtMedium
Q9LG41Oryza sativa subsp. japonicasp|Q9LG41|YUC4_ORYSJ Indole-3-pyruvate monooxygenase YUCCA438.000%Swiss-ProtMedium

JBrowse

View in Genome Browser