TkA04G120270 | RubberDandelionOmics

Gene overview

TkA04G120270

Reference: TK1151 Chr: Chr04 Coordinates: 31245728-31246268 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · TkA04G120270|TK1151|cDNA

ATGTTTGGTGGGCAAAAACGCGCACTCCACAATCTAAAACAAAAACTACTTGGCGACTCATCTTTCACAACATCGATCAATGAAATCCCACCTGAAATCGAATTATCGGATTACCAAAGAGCACCAAGTCCAGGTTCCGAAAGCCCTTCAGGTCTTCTCAATGGTGAAAGCTTAAAAGTCGAACCAATTGCTGACTTGGATCTCTTCTTTGAAAGATTATACAGCTACTACTGTGAAAAGGGTCTATGGTGCATAATCAT...

CDS

Download CDS FASTA

495 bp · TkA04G120270|TK1151|CDS

ATGTTTGGTGGGCAAAAACGCGCACTCCACAATCTAAAACAAAAACTACTTGGCGACTCATCTTTCACAACATCGATCAATGAAATCCCACCTGAAATCGAATTATCGGATTACCAAAGAGCACCAAGTCCAGGTTCCGAAAGCCCTTCAGGTCTTCTCAATGGTGAAAGCTTAAAAGTCGAACCAATTGCTGACTTGGATCTCTTCTTTGAAAGATTATACAGCTACTACTGTGAAAAGGGTCTATGGTGCATAATCAT...

Protein

Download Protein FASTA

164 aa · TkA04G120270|TK1151|PROTEIN

MFGGQKRALHNLKQKLLGDSSFTTSINEIPPEIELSDYQRAPSPGSESPSGLLNGESLKVEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELLSLAFTICFSGFFLLFVDWNGLRSAKCGMDAVESGIKPCDLAKEALHEHPLTPLTPFKVVILGSLYSLRIH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G120270`
TK1151 ID	TkA04G120270
OH-1004 ID	LXL04_035618
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 96.341 / OH-1004 76.329 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G120270

Location Chr04:31245728-31246268 (-)

Description Similar to ATG9: Autophagy-related protein 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31260`	Phospholipid scramblase involved in autophagy by mediating autophagosomal membrane expansion.	Leaf senescence and starvation-induced chlorosis are accelerated by the disruption of an Arabidopsis autophagy gene.2002 · DOI: 10.1104/pp.011024 A revised assay for monitoring autophagic flux in Arabidopsis thaliana reveals involvement of AUTOPHAGY-RELATED9 in autophagy.2014 · DOI: 10.14348/molcells.2014.0042

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035618 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000422 autophagy of mitochondrion Biological Process

GO:0000423 mitophagy Biological Process

GO:0006907 pinocytosis Biological Process

GO:0006909 phagocytosis Biological Process

GO:0006914 autophagy Biological Process

GO:0009408 response to heat Biological Process

GO:0009617 response to bacterium Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0019954 asexual reproduction Biological Process

GO:0031667 response to nutrient levels Biological Process

GO:0032688 negative regulation of interferon-beta production Biological Process

KEGG gene cross-reference

ath:AT2G31260

ddi:DDB_G0285323

hsa:79065

pon:100174344

rno:363254

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.331

Rank 1 · TkA04G120270 · TK1151

Golgi apparatus0.321

Rank 2 · TkA04G120270 · TK1151

Cytoplasm0.218

Rank 3 · TkA04G120270 · TK1151

Lysosome / Vacuole0.181

Rank 4 · TkA04G120270 · TK1151

Cell membrane0.149

Rank 5 · TkA04G120270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04109ATG960-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G120270	`PF04109`	ATG9	60	117	6.3e-19	69.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RUS5`	Arabidopsis thaliana	sp\|Q8RUS5\|ATG9_ARATH Autophagy-related protein 9	70.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card