TkA04G119740 | RubberDandelionOmics

Gene overview

TkA04G119740

Reference: TK1151 Chr: Chr04 Coordinates: 31129969-31132851 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1934 bp · TkA04G119740|TK1151|cDNA

AAGTTTATTTGTGTTGCGTTAACATTACTGGATATGAATGAATATGTACTTTCTAGTGCCACCGATTATCGTCGATACCGTGAGTCAGTTACGGTGGCGATTGTTGGAGTTGCAGTCTTCACAAACCTCAGAAAAAAAAATTACAATCACGCATCAAGAACAAGAACACTCTATCTGCATCTGTTCATTCCGAAATCGGCACTTAATCATTCAAACTTCCGATGATTGTATAGCTGCTGACCTTTGTGCGCATCCATGAA...

CDS

Download CDS FASTA

1536 bp · TkA04G119740|TK1151|CDS

ATGAACAATATGAAGAACCACGACAATCAGAAGCATCAAACTAGTAGGGACGCTATACCAGCTTCTACCTTATGGACTGACGGACTACTCTGTGCCTTTGAAGCTCATCATGGCCACAAAAAACACAAACCACAAGACACAATCAGGGAAAAAAAACACATATTCAAAACCATAAGAACCACATCATCATATGGAGATGCAATCAACACTTTGGATGACAACACACAAACCGGAAATCACTGGATACCAATCGGCTGGTC...

Protein

Download Protein FASTA

511 aa · TkA04G119740|TK1151|PROTEIN

MNNMKNHDNQKHQTSRDAIPASTLWTDGLLCAFEAHHGHKKHKPQDTIREKKHIFKTIRTTSSYGDAINTLDDNTQTGNHWIPIGWSRISQLVESIQVNNNWETQNTEFTFSDDEVTVADIAVPYREQAVGPTWWCHVDAGHPSVKSWLTNSKWLHPAISIALRDESKLISERMKHLLYEVPVRVAGGLLFELLGQSAGDPYVEEDDIPVVLRSWQAQNFLVTALHVKGSGTNINVLGVSEVQELLAAGGSNVPQTIHEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G119740`
TK1151 ID	TkA04G119740
OH-1004 ID	LXL04_035624
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.700
Protein coverage (%)	TK1151 91.977 / OH-1004 76.346 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G119740`
Location	Chr04:31129969-31132851 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035624` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006824 cobalt ion transport Biological Process GO:0006829 zinc ion transport Biological Process GO:0015675 nickel cation transport Biological Process GO:0005886 plasma membrane Cellular Component GO:0046873 metal ion transmembrane transporter activity Molecular Function
KEGG gene cross-reference	pae:PA1773 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.309

Rank 1 · TkA04G119740 · TK1151

Nucleus0.271

Rank 2 · TkA04G119740 · TK1151

Endoplasmic reticulum0.183

Rank 3 · TkA04G119740 · TK1151

Cell membrane0.162

Rank 4 · TkA04G119740 · TK1151

Mitochondrion0.144

Rank 5 · TkA04G119740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07332Phage_holin_3_640-57 aa

PF01544CorA309-445 aa

PF29168DUF8506344-374 aa

PF07332Phage_holin_3_6396-463 aa

PF28880T2SSM_N440-488 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G119740	`PF07332`	Phage_holin_3_6	40	57	0.11	13.3
TkA04G119740	`PF01544`	CorA	309	445	4.9e-11	43.2
TkA04G119740	`PF29168`	DUF8506	344	374	0.19	12.2
TkA04G119740	`PF07332`	Phage_holin_3_6	396	463	0.11	13.3
TkA04G119740	`PF28880`	T2SSM_N	440	488	0.023	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card