TkA04G116970 | RubberDandelionOmics

Gene overview

TkA04G116970

Reference: TK1151 Chr: Chr04 Coordinates: 30422610-30427595 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2839 bp · TkA04G116970|TK1151|cDNA

TTTGCCTCCGTTTTTTCCCGTCCCTCTCGTATAGCTCGTCTTCGGTCCCAATTCTCCAATTTTATGCTGACGCGGTCTCTCACTTTGACTTTTTTATCGGATTCGAGGGCGTAAAGACGCGGAAAAATGGTCTTGACTCTTGAGTGTTCCTAGCTCGAGCCATTTATCTTCCCAGAATCTGGTAGCCTCTCCATCTCCTGAAAAAATTTCTCAATTTATTAATGAAAATGTGATTCATTCTTGTTTTGTAATTGGAGCTG...

CDS

Download CDS FASTA

2322 bp · TkA04G116970|TK1151|CDS

ATGGGCGATGGCGATGAGCTACACGAAGAAGAACGTTTTGACGTCCTCACTAAAACCGGTCTGAAAACTGGTATCTCTAAACCCAGAAGCGCCGTTCACAGAGATGGGGATTATCACCGCGCTGTTCATGTATGGATTTTTGCTGAAAGTACGCAACAACTTCTTCTTCAAAAACGTGCGGATCACAAGGATTCATGGCCTGGATTGTGGGATATCTCTAGCGCAGGCCATGTATCTGCTGGAGATACGTCCCTTATCAC...

Protein

Download Protein FASTA

773 aa · TkA04G116970|TK1151|PROTEIN

MGDGDELHEEERFDVLTKTGLKTGISKPRSAVHRDGDYHRAVHVWIFAESTQQLLLQKRADHKDSWPGLWDISSAGHVSAGDTSLITARRELLEELGVNLPNDAFELLFVFLQECVTNGGKFIDNEFDDVYLVTTLSPIPLEAFTLQESEVSAVKYISIEEYKNLLVKEDPQYVPYNLDGQYGQLFDIITKRYQDNVEAQSISLQKKLNRYSPISLDAELTGLTDEDKQVLVLLIQAAKIVDDVFYNQVWYSNPSLREWL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G116970`
TK1151 ID	TkA04G116970
OH-1004 ID	LXL04_035644
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 91.407 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G116970

Location Chr04:30422610-30427595 (+)

Description Similar to NUDT3: Nudix hydrolase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79690`	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035644 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008239 dipeptidyl-peptidase activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0016791 phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G79690

bth:BT_1846

caby:Cabys_2252

lin:lin0387

lmo:lmo0368

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.678

Rank 1 · TkA04G116970 · TK1151

Nucleus0.283

Rank 2 · TkA04G116970 · TK1151

Peroxisome0.115

Rank 3 · TkA04G116970 · TK1151

Mitochondrion0.099

Rank 4 · TkA04G116970 · TK1151

Cell membrane0.058

Rank 5 · TkA04G116970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00293NUDIX38-170 aa

PF01468GA220-244 aa

PF03571Peptidase_M49392-599 aa

PF30221DUF8614398-750 aa

PF00190Cupin_1496-560 aa

PF03571Peptidase_M49610-635 aa

PF01468GA618-638 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G116970	`PF00293`	NUDIX	38	170	1.8e-16	61.0
TkA04G116970	`PF01468`	GA	220	244	0.15	13.0
TkA04G116970	`PF03571`	Peptidase_M49	392	599	4.6e-10	39.2
TkA04G116970	`PF30221`	DUF8614	398	750	7.3e-13	48.9
TkA04G116970	`PF00190`	Cupin_1	496	560	0.31	11.3
TkA04G116970	`PF03571`	Peptidase_M49	610	635	4.6e-10	39.2
TkA04G116970	`PF01468`	GA	618	638	0.15	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L831`	Arabidopsis thaliana	sp\|Q8L831\|NUDT3_ARATH Nudix hydrolase 3	70.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card