TkA04G116590 | RubberDandelionOmics

Gene overview

TkA04G116590

Reference: TK1151 Chr: Chr04 Coordinates: 30306897-30308143 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1047 bp · TkA04G116590|TK1151|cDNA

GAAAAACACCCCCTTCTGTACACACAGTTGACGAAATACATACACGTTAGGCGTATCTATATATACAAACACACAGAGACATCTGCCTAACTGATCATACAAACTCACAACCATTTACACCAAAAAAAAACCTCCAGAAACAGAATATGAAGATCCCTGTGCTCGAGAATTTCATGTTTGATGAACCATCGGTTTGGATTACAATAACGACGGTGGTGACGTTGATTTCAACGGTTTACTTAGGTTTTTCAGAGATGATA...

CDS

Download CDS FASTA

795 bp · TkA04G116590|TK1151|CDS

ATGAAGATCCCTGTGCTCGAGAATTTCATGTTTGATGAACCATCGGTTTGGATTACAATAACGACGGTGGTGACGTTGATTTCAACGGTTTACTTAGGTTTTTCAGAGATGATAGGGAATCATCTCCAGTATTCAAAATTTGCCGACGTTAAACCTTCAACAACACAAGGAACTAAGCTATCAAGCAGAACAGGTTTTTTGATTCTCTACACGCCGGCGTTCCTCGCCGGACTTGTTTCCTTCTTCGTCTTCCCTAGCGG...

Protein

Download Protein FASTA

264 aa · TkA04G116590|TK1151|PROTEIN

MKIPVLENFMFDEPSVWITITTVVTLISTVYLGFSEMIGNHLQYSKFADVKPSTTQGTKLSSRTGFLILYTPAFLAGLVSFFVFPSGGIRFLLLKFAVTFHFFKRDLEVLFLHKYSGGMILGSTILISIFYLSAAVSMIVVHYLSLGLPDPSIDLKYIGLILFLVGISGNFYHHKLLSKLRTANEKGYKIPHGGLFNLVICPHYLFEIIIFVGMSFISQTPLAFACTFGDSMYLIARSYETRKWYVNKFEDFPKNIKCVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G116590`
TK1151 ID	TkA04G116590
OH-1004 ID	LXL04_035650
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G116590`
Location	Chr04:30306897-30308143 (-)
Description	Similar to DET2: Steroid 5-alpha-reductase DET2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035650` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006665 sphingolipid metabolic process Biological Process GO:0006694 steroid biosynthetic process Biological Process GO:0006702 androgen biosynthetic process Biological Process GO:0007548 sex differentiation Biological Process GO:0009416 response to light stimulus Biological Process GO:0010268 brassinosteroid homeostasis Biological Process GO:0016132 brassinosteroid biosynthetic process Biological Process GO:0030154 cell differentiation Biological Process GO:0030497 fatty acid elongation Biological Process GO:0042761 very long-chain fatty acid biosynthetic process Biological Process GO:0061370 testosterone biosynthetic process Biological Process GO:0090377 seed trichome initiation Biological Process
KEGG gene cross-reference	ath:AT2G38050 bdi:100827766 ddi:DDB_G0270270 ghi:107948867 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.869

Rank 1 · TkA04G116590 · TK1151

Nucleus0.073

Rank 2 · TkA04G116590 · TK1151

Cytoplasm0.064

Rank 3 · TkA04G116590 · TK1151

Golgi apparatus0.053

Rank 4 · TkA04G116590 · TK1151

Cell membrane0.038

Rank 5 · TkA04G116590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04191PEMT16-36 aa

PF02544Steroid_dh17-84 aa

PF04191PEMT89-112 aa

PF06966DUF1295126-222 aa

PF04191PEMT130-130 aa

PF02544Steroid_dh156-264 aa

PF04191PEMT157-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G116590	`PF04191`	PEMT	16	36	0.00021	22.4
TkA04G116590	`PF02544`	Steroid_dh	17	84	2e-26	93.5
TkA04G116590	`PF04191`	PEMT	89	112	0.00021	22.4
TkA04G116590	`PF06966`	DUF1295	126	222	0.0013	19.0
TkA04G116590	`PF04191`	PEMT	130	130	0.00021	22.4
TkA04G116590	`PF02544`	Steroid_dh	156	264	2e-26	93.5
TkA04G116590	`PF04191`	PEMT	157	240	0.00021	22.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card