RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G114660
Reference: TK1151 Chr: Chr04 Coordinates: 29768004-29770232 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1674 bp · TkA04G114660|TK1151|cDNA

ATGAAAAGAAATGGTATTCCTAGTTTGTGCTTACGACTGCTAATCATATTAGCTTTCTTTTCTACAAGTAATGCCGTTCAATCAGACATCGATTGCCTAAGATCTATTAAGAAATCGTTGGAAGACCCTTTAGGTTCTCTTTCTAGCTGGAATTTTAACAACAATACTGAAGTTGGCATAAGAAACTGCATCAGCATGCAAAGTTTAGATCTTTCCGGAAACTACTTCTCAGGACCGATTCCTTCTACTATCGGTGATGA...

CDS

Download CDS FASTA

1674 bp · TkA04G114660|TK1151|CDS

ATGAAAAGAAATGGTATTCCTAGTTTGTGCTTACGACTGCTAATCATATTAGCTTTCTTTTCTACAAGTAATGCCGTTCAATCAGACATCGATTGCCTAAGATCTATTAAGAAATCGTTGGAAGACCCTTTAGGTTCTCTTTCTAGCTGGAATTTTAACAACAATACTGAAGTTGGCATAAGAAACTGCATCAGCATGCAAAGTTTAGATCTTTCCGGAAACTACTTCTCAGGACCGATTCCTTCTACTATCGGTGATGA...

Protein

Download Protein FASTA

557 aa · TkA04G114660|TK1151|PROTEIN

MKRNGIPSLCLRLLIILAFFSTSNAVQSDIDCLRSIKKSLEDPLGSLSSWNFNNNTEVGIRNCISMQSLDLSGNYFSGPIPSTIGDDLAYMVDLNLSNNNLSGPIPPTIANFSFINVLRLDNNRLRGQIPLEFSKLNRIMVFSVANNSLSGPMPIFSTTNFSAESYANNVGLCGGPLNARKEGHDVYFFYSGFAVGFSLFTLLSMLFMFLCWPRLHTRGLRYYHLLTKKLERGKHHQIPVIPQILFVEDVGSMETKVTAM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G114660
TK1151 IDTkA04G114660
OH-1004 IDLXL04_035701
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)72.500
Protein coverage (%)TK1151 85.458 / OH-1004 39.015
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G114660
LocationChr04:29768004-29770232 (-)
DescriptionSimilar to BIR2: Inactive LRR receptor-like serine/threonine-protein kinase BIR2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g48380 Probably inactive leucine-rich repeat receptor-like protein kinase At5g48380. No verified direct reference in this release
At3g28450 Pseudokinases lacking protein kinase activity and unable to bind ATP-analogs.
Structure of the pseudokinase domain of BIR2, a regulator of BAK1-mediated immune signaling in Arabidopsis.2014 · DOI: 10.1016/j.jsb.2014.02.005
At1g27190 Probable inactive receptor kinase At1g27190. No verified direct reference in this release
At1g69990 Probable LRR receptor-like serine/threonine-protein kinase At1g69990. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os08g0342300 May be involved in brassenosteroid (BR) perception in roots.
The role of OsBRI1 and its homologous genes, OsBRL1 and OsBRL3, in rice.2006 · DOI: 10.1104/pp.105.072330
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035701 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0006952 defense response Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0031348 negative regulation of defense response Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0045088 regulation of innate immune response Biological Process
GO:1900150 regulation of defense response to fungus Biological Process
GO:1900425 negative regulation of defense response to bacterium Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT1G27190
ath:AT1G69990
ath:AT3G28450
ath:AT5G48380
ath:AT5G64920
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.858
Rank 1 · TkA04G114660 · TK1151
Cytoplasm0.081
Rank 2 · TkA04G114660 · TK1151
Endoplasmic reticulum0.076
Rank 3 · TkA04G114660 · TK1151
Nucleus0.060
Rank 4 · TkA04G114660 · TK1151
Lysosome / Vacuole0.023
Rank 5 · TkA04G114660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_227-56 aa
PF12799LRR_456-75 aa
PF13855LRR_865-125 aa
PF00560LRR_166-85 aa
PF00560LRR_194-112 aa
PF12799LRR_494-125 aa
PF00560LRR_1116-136 aa
PF13855LRR_8116-150 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G114660PF08263LRRNT_227561.1e-0526.3
TkA04G114660PF12799LRR_456750.0315.3
TkA04G114660PF13855LRR_8651250.006217.0
TkA04G114660PF00560LRR_166851.3e-1143.0
TkA04G114660PF00560LRR_1941121.3e-1143.0
TkA04G114660PF12799LRR_4941250.0315.3
TkA04G114660PF00560LRR_11161361.3e-1143.0
TkA04G114660PF13855LRR_81161500.006217.0
TkA04G114660PF00560LRR_11411541.3e-1143.0
TkA04G114660PF00069Pkinase2804774.7e-2279.4
TkA04G114660PF07714PK_Tyr_Ser-Thr2824781.6e-2797.2
TkA04G114660PF24476DUF75803755220.03514.4
TkA04G114660PF08263LRRNT_24714841.1e-0526.3
TkA04G114660PF13855LRR_85385510.006217.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ASS4Arabidopsis thalianasp|Q9ASS4|Y5838_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g4838037.000%Swiss-ProtMedium
Q9LSI9Arabidopsis thalianasp|Q9LSI9|BIR2_ARATH Inactive LRR receptor-like serine/threonine-protein kinase BIR238.400%Swiss-ProtMedium
O04567Arabidopsis thalianasp|O04567|Y1719_ARATH Probable inactive receptor kinase At1g2719039.100%Swiss-ProtMedium
C0LGI5Arabidopsis thalianasp|C0LGI5|Y1699_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g6999037.700%Swiss-ProtMedium
Q6ZCZ2Oryza sativa subsp. japonicasp|Q6ZCZ2|BRL3_ORYSJ Brassinosteroid LRR receptor kinase BRL332.900%Swiss-ProtMedium

JBrowse

View in Genome Browser