TkA04G114570 | RubberDandelionOmics

Gene overview

TkA04G114570

Reference: TK1151 Chr: Chr04 Coordinates: 29745873-29746419 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

447 bp · TkA04G114570|TK1151|cDNA

ATGATCAACACCTTGCCAGAATCGTGTTATGAGTTGTCGCTTGAAGACATAGTGGTCAAGGATCCAAATAACATAGAATCATTGATGAAAGATAGGGTGGATATGACGCTCGAGTTGGAGGGAAAGAATAAAGGTACGAAAAAGAGTCGAATTTCAAGGAGTGTGAGCCTTGATACTGGAGTTTTCCTCCTAAAGACTTTCGTCCCTAGTTCCTTTGGCTCAAAGAAACATAAGGTTTCTCAAAGTACGTCAGTTGGTGA...

CDS

Download CDS FASTA

447 bp · TkA04G114570|TK1151|CDS

ATGATCAACACCTTGCCAGAATCGTGTTATGAGTTGTCGCTTGAAGACATAGTGGTCAAGGATCCAAATAACATAGAATCATTGATGAAAGATAGGGTGGATATGACGCTCGAGTTGGAGGGAAAGAATAAAGGTACGAAAAAGAGTCGAATTTCAAGGAGTGTGAGCCTTGATACTGGAGTTTTCCTCCTAAAGACTTTCGTCCCTAGTTCCTTTGGCTCAAAGAAACATAAGGTTTCTCAAAGTACGTCAGTTGGTGA...

Protein

Download Protein FASTA

148 aa · TkA04G114570|TK1151|PROTEIN

MINTLPESCYELSLEDIVVKDPNNIESLMKDRVDMTLELEGKNKGTKKSRISRSVSLDTGVFLLKTFVPSSFGSKKHKVSQSTSVGDSKKPPVDVKRWKTWLFVENNGNLSSGSCNTNTCHSTPPKTRKFYGCLGTSKRTNKKGCIFF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G114570`
TK1151 ID	TkA04G114570
OH-1004 ID	LXL04_035701
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.100
Protein coverage (%)	TK1151 98.649 / OH-1004 13.542 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G114570`
Location	Chr04:29745873-29746419 (-)
Description	Similar to BIR2: Inactive LRR receptor-like serine/threonine-protein kinase BIR2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035701` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0006952 defense response Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031348 negative regulation of defense response Biological Process GO:0042742 defense response to bacterium Biological Process GO:0045088 regulation of innate immune response Biological Process GO:1900150 regulation of defense response to fungus Biological Process GO:1900425 negative regulation of defense response to bacterium Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	ath:AT1G27190 ath:AT1G69990 ath:AT3G28450 ath:AT5G48380 ath:AT5G64920 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.423

Rank 1 · TkA04G114570 · TK1151

Nucleus0.395

Rank 2 · TkA04G114570 · TK1151

Cytoplasm0.309

Rank 3 · TkA04G114570 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA04G114570 · TK1151

Plastid0.037

Rank 5 · TkA04G114570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06839Zn_ribbon_GRF40-46 aa

PF06839Zn_ribbon_GRF114-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G114570	`PF06839`	Zn_ribbon_GRF	40	46	0.69	10.8
TkA04G114570	`PF06839`	Zn_ribbon_GRF	114	148	0.69	10.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card