TkA04G114530 | RubberDandelionOmics

Gene overview

TkA04G114530

Reference: TK1151 Chr: Chr04 Coordinates: 29734977-29736268 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

664 bp · TkA04G114530|TK1151|cDNA

CCTAATTAGATATTTAGGTTTTGATATTTATATTCTTTTCTTTATATGCATTTGATAGAGGTTTCTGTTAGATGCTTGTCGCGATACAACATTGATCATTTTAATGGTAGCTGCTGCTGCTTCTTTGGCACTTGGTATAAAAACAGAGGGGATAAAAGAAGGGTGGTATGATGGTGGAAGCATAGCTTTGGCTGTTATAATTGTCATAGTCGTTACAGCTATAAGTGATTACAAACAATCACTTCAATTTCAGAACTTAA...

CDS

Download CDS FASTA

417 bp · TkA04G114530|TK1151|CDS

ATGGTAGCTGCTGCTGCTTCTTTGGCACTTGGTATAAAAACAGAGGGGATAAAAGAAGGGTGGTATGATGGTGGAAGCATAGCTTTGGCTGTTATAATTGTCATAGTCGTTACAGCTATAAGTGATTACAAACAATCACTTCAATTTCAGAACTTAAACGAAGAGAAGCAGAATATACACCTGGAGGTTGTAAGAGGTGGAAGGAGGATCGAGATTTCAATATTTGATATCGTTGTAGGTGATGTCATACCTCTTAAAAT...

Protein

Download Protein FASTA

138 aa · TkA04G114530|TK1151|PROTEIN

MVAAAASLALGIKTEGIKEGWYDGGSIALAVIIVIVVTAISDYKQSLQFQNLNEEKQNIHLEVVRGGRRIEISIFDIVVGDVIPLKIGDQVPADGVLISGHSLSIDESSMTGESKIVHKDHKNPFLMSGCKVVDGYGH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G114530`
TK1151 ID	TkA04G114530
OH-1004 ID	LXL04_027187
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 99.275 / OH-1004 21.142 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G114530

Location Chr04:29734977-29736268 (+)

Description Similar to PAB2: Polyadenylate-binding protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57110`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell.	No verified direct reference in this release
`At3g21180`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.	No verified direct reference in this release
`At4g29900`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the endoplasmic reticulum.	No verified direct reference in this release
`At3g63380`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0605500`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027187 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process

GO:0006413 translational initiation Biological Process

GO:0006417 regulation of translation Biological Process

GO:0006446 regulation of translational initiation Biological Process

GO:0048255 mRNA stabilization Biological Process

GO:0060211 regulation of nuclear-transcribed mRNA poly(A) tail shortening Biological Process

GO:1900151 regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G49760

ath:AT4G34110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.400

Rank 1 · TkA04G114530 · TK1151

Lysosome / Vacuole0.203

Rank 2 · TkA04G114530 · TK1151

Endoplasmic reticulum0.203

Rank 3 · TkA04G114530 · TK1151

Cytoplasm0.184

Rank 4 · TkA04G114530 · TK1151

Golgi apparatus0.159

Rank 5 · TkA04G114530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00122E1-E2_ATPase60-136 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G114530	`PF00122`	E1-E2_ATPase	60	136	2.6e-18	66.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LF79`	Arabidopsis thaliana	sp\|Q9LF79\|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type	86.200%	Swiss-Prot	High
`Q9LU41`	Arabidopsis thaliana	sp\|Q9LU41\|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type	81.000%	Swiss-Prot	High
`Q9SZR1`	Arabidopsis thaliana	sp\|Q9SZR1\|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type	79.700%	Swiss-Prot	High
`Q9LY77`	Arabidopsis thaliana	sp\|Q9LY77\|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type	60.600%	Swiss-Prot	High
`Q7X8B5`	Oryza sativa subsp. japonica	sp\|Q7X8B5\|ACA5_ORYSJ Calcium-transporting ATPase 5, plasma membrane-type	85.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card