TkA04G110170 | RubberDandelionOmics

Gene overview

TkA04G110170

Reference: TK1151 Chr: Chr04 Coordinates: 28646271-28651324 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3665 bp · TkA04G110170|TK1151|cDNA

CCAACTTGTAAACAATTCTACGATAGTGAGAATATTATTGGGTTCCATTGAGTTGAGCTAATTTGACACACAACAATATGTATTTATACATTTACAAACATAGTTACATGTGTCTTTACGTTTTTTTTGAAATGTATAAATACTGATTCTGATAGTAATCCAAAAATACCTTCCATGATAAAACTAAAACAACAGAAGTTAAAGGACCAAAAAATTATTTTTACCTAATACAGCAAAAAATATGATTTTCTGTACACTGT...

CDS

Download CDS FASTA

2418 bp · TkA04G110170|TK1151|CDS

ATGGAGAAAAAACAGAAGAAGTTTCTAACAGTCGCACCCTTCGAATGTGCCTGGCGTGACGATTTGAGATTCAAAGAAGCTGGAAGAGGGTGTGTCGCATTTGAAGCATTCGCTCACAATGACGTCACCGTCGTCTTCCGTGAGCAATTAGGCAGTCAACACTACCATTACAAAAGGGACAACAGTCCTCATTATACGGTAATCATAGGTAGCCATAGAAACCGTAGGTTAAAAATCGAGGTAGATGGGATCACCACAGT...

Protein

Download Protein FASTA

805 aa · TkA04G110170|TK1151|PROTEIN

MEKKQKKFLTVAPFECAWRDDLRFKEAGRGCVAFEAFAHNDVTVVFREQLGSQHYHYKRDNSPHYTVIIGSHRNRRLKIEVDGITTVDEAGLGLCCSSAFQSYWISICDGLISVGKGRYPFQNLIFQWLDTKPNCSVQYVGLSSWDKHVGYRNVNVLPLTQNHISLWKHVDCGEYNGEDDTEEDLRGEFGNFDNHQGLGSFLENWELSDVYFIVGNEENAVPAHKLILAAVDSFDLSLLDQDFIAIKDVTYPVLHAFLRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G110170`
TK1151 ID	TkA04G110170
OH-1004 ID	LXL04_035762
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G110170

Location Chr04:28646271-28651324 (+)

Description Similar to At2g30600/At2g30610: BTB/POZ domain-containing protein At2g30600

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q8LEV3`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035762 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006895 Golgi to endosome transport Biological Process

GO:0015031 protein transport Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045746 negative regulation of Notch signaling pathway Biological Process

GO:0045747 positive regulation of Notch signaling pathway Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0070534 protein K63-linked ubiquitination Biological Process

KEGG gene cross-reference

ath:AT2G30600

cel:CELE_C34D4.14

gga:425091

hsa:25831

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.584

Rank 1 · TkA04G110170 · TK1151

Nucleus0.306

Rank 2 · TkA04G110170 · TK1151

Mitochondrion0.114

Rank 3 · TkA04G110170 · TK1151

Cell membrane0.104

Rank 4 · TkA04G110170 · TK1151

Endoplasmic reticulum0.092

Rank 5 · TkA04G110170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12248Methyltransf_FA14-155 aa

PF00651BTB200-297 aa

PF21536BTB_KLHL33241-265 aa

PF21913ORC6_2nd275-307 aa

PF00651BTB341-451 aa

PF21536BTB_KLHL33379-417 aa

PF07707BACK427-454 aa

PF07707BACK466-529 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G110170	`PF12248`	Methyltransf_FA	14	155	6.9e-30	104.3
TkA04G110170	`PF00651`	BTB	200	297	1.1e-29	103.6
TkA04G110170	`PF21536`	BTB_KLHL33	241	265	7.9e-08	32.8
TkA04G110170	`PF21913`	ORC6_2nd	275	307	0.047	14.9
TkA04G110170	`PF00651`	BTB	341	451	1.1e-29	103.6
TkA04G110170	`PF21536`	BTB_KLHL33	379	417	7.9e-08	32.8
TkA04G110170	`PF07707`	BACK	427	454	8.1e-06	26.6
TkA04G110170	`PF07707`	BACK	466	529	8.1e-06	26.6
TkA04G110170	`PF00754`	F5_F8_type_C	662	751	4.1e-09	37.3
TkA04G110170	`PF22633`	F5_F8_type_C_2	699	751	0.0016	19.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LEV3`	Arabidopsis thaliana	sp\|Q8LEV3\|Y2060_ARATH BTB/POZ domain-containing protein At2g30600	64.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card