TkA04G106510 | RubberDandelionOmics

Gene overview

TkA04G106510

Reference: TK1151 Chr: Chr04 Coordinates: 27717299-27721949 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2557 bp · TkA04G106510|TK1151|cDNA

AAAAAACTGGCTGCCGTCTTTTTTTTTTCTTCAGTTCCTAGCAGCAGCCACCGGCACCACACGAGCCACACTCTTTCTTCCCCTCCACCACCAGCGCCGCGCTTTTCCTTCCCGGCAGTCACAGGTCCAGTCATCAGGTAGCACCTAGTGAAACTCTTCCAAGTTAAAAATGGATAATGAAGTTGGAAATAAATCCCGTAAAGAGAAACGGAAAGAAGCTCGATTAGATAAGAATAAGAAAAAGTTTGACTCATGGGTCC...

CDS

Download CDS FASTA

1356 bp · TkA04G106510|TK1151|CDS

ATGAAGAAATTCTGGCATCGTGTGCGGGTGGACCCCGCGGTAATGAACAGGTATGCTTCTGTATTTGCGGCTTTGGTTGCTGGATTGGCTTCTTTGGTTGGAATTGACTTTGGTGCAAAGCTTCTTGCATCACTCGCAAAGTGTTTTGAGGATGAATACGCGAAAGAAGACAATCTTTCCTTGAGGAATTTGACTCTTCTTCTTTCTTATTTATACATATTTGGAGTTTGTTCAAGTGATTTAATCTATGATTTCATGAT...

Protein

Download Protein FASTA

451 aa · TkA04G106510|TK1151|PROTEIN

MKKFWHRVRVDPAVMNRYASVFAALVAGLASLVGIDFGAKLLASLAKCFEDEYAKEDNLSLRNLTLLLSYLYIFGVCSSDLIYDFMMMLSSRLTEVDVSTILTVLNCSGMRLRSDDPATMKNFIVSIQNKVAELKAASSDNQAKSKRMEFMLETIFDIKNNKKKVKEDTSQHTRIKKWLQKLRVESILVRGLKWNKLIDPNKKGQWWLTGDSMMPLSISDSIETVAKKIDKENSEAQKMLQLAAGQRMNTDARRAIFCII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G106510`
TK1151 ID	TkA04G106510
OH-1004 ID	LXL04_022002
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	29.900
Protein coverage (%)	TK1151 29.712 / OH-1004 14.363 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G106510`
Location	Chr04:27717299-27721949 (+)
Description	Similar to Cwc22: Pre-mRNA-splicing factor CWC22 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022002` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0048024 regulation of mRNA splicing, via spliceosome Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005829 cytosol Cellular Component GO:0016607 nuclear speck Cellular Component GO:0071005 U2-type precatalytic spliceosome Cellular Component GO:0071006 U2-type catalytic step 1 spliceosome Cellular Component GO:0071007 U2-type catalytic step 2 spliceosome Cellular Component GO:0071013 catalytic step 2 spliceosome Cellular Component GO:0071018 U12-type catalytic step 2 spliceosome Cellular Component
KEGG gene cross-reference	hsa:57703 mmu:80744 xla:734468 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.596

Rank 1 · TkA04G106510 · TK1151

Nucleus0.235

Rank 2 · TkA04G106510 · TK1151

Golgi apparatus0.211

Rank 3 · TkA04G106510 · TK1151

Lysosome / Vacuole0.118

Rank 4 · TkA04G106510 · TK1151

Endoplasmic reticulum0.098

Rank 5 · TkA04G106510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02854MIF4G20-162 aa

PF25762HAUS197-173 aa

PF06005ZapB126-183 aa

PF02847MA3253-355 aa

PF02854MIF4G282-361 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G106510	`PF02854`	MIF4G	20	162	9.7e-19	68.6
TkA04G106510	`PF25762`	HAUS1	97	173	0.015	15.9
TkA04G106510	`PF06005`	ZapB	126	183	0.08	14.2
TkA04G106510	`PF02847`	MA3	253	355	2.6e-20	73.2
TkA04G106510	`PF02854`	MIF4G	282	361	9.7e-19	68.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card