TkA04G106070 | RubberDandelionOmics

Gene overview

TkA04G106070

Reference: TK1151 Chr: Chr04 Coordinates: 27607307-27609248 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1854 bp · TkA04G106070|TK1151|cDNA

ATAATTCAAGAGTCAGTATTTCCCAACAACCATTTCCAAGCTTATTCTTGTTAAATATTATCTTTTTGCTATTCAAACAAATGAATTCATCAAACCCTGTTACTGTCTTTTAACAATTACCAAAGAAACAACACCATGAATCTGGAAAACTTCACAAAGGAAGAGATGATCATGTTCTTGATTCCATGGCCACTCCTTTTCTTCTTCTTCTTCATCCTCCATAAAATTAAACCCTCAAAAGAGCTACCACTTCCACCAGG...

CDS

Download CDS FASTA

1515 bp · TkA04G106070|TK1151|CDS

ATGAATCTGGAAAACTTCACAAAGGAAGAGATGATCATGTTCTTGATTCCATGGCCACTCCTTTTCTTCTTCTTCTTCATCCTCCATAAAATTAAACCCTCAAAAGAGCTACCACTTCCACCAGGTCCACATCCATGGCCAATCGTAGGCAACCTTTTCCAAATCGGAAAGAACGCTCATATTGATCTTGCTGAGATGGCTCAAATCCATGGACCAATCATGTCACTCCGCTTAGGTCAAAGAATCCTGATCGTCGGATC...

Protein

Download Protein FASTA

504 aa · TkA04G106070|TK1151|PROTEIN

MNLENFTKEEMIMFLIPWPLLFFFFFILHKIKPSKELPLPPGPHPWPIVGNLFQIGKNAHIDLAEMAQIHGPIMSLRLGQRILIVGSSSAAASEILKAHDHVLSGRDVSVLLQNKVSTVHNMNLVFTSETGDNWRKIRNLYTSQIFSNKALESRVNMRQEKVMEMVKFIGSKSGESLSIRDAMLVTVTNIMGNVSLSMDLMDFEGNGIGAKINDSLRRLTMLGGQPPLADFYPIFGRWDMQGWYKKFMQIVKQELGTIWE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G106070`
TK1151 ID	TkA04G106070
OH-1004 ID	LXL04_035814
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G106070`
Location	Chr04:27607307-27609248 (+)
Description	Similar to CYP80B3: (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035814` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002238 response to molecule of fungal origin Biological Process GO:0009820 alkaloid metabolic process Biological Process GO:0033075 isoquinoline alkaloid biosynthetic process Biological Process GO:0044550 secondary metabolite biosynthetic process Biological Process GO:1901012 (S)-reticuline biosynthetic process Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0004497 monooxygenase activity Molecular Function GO:0005506 iron ion binding Molecular Function GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function GO:0020037 heme binding Molecular Function GO:0050593 N-methylcoclaurine 3'-monooxygenase activity Molecular Function
KEGG gene cross-reference	ag:AAC39452 ag:ABD39696 ag:BAF80448 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.913

Rank 1 · TkA04G106070 · TK1151

Cell membrane0.038

Rank 2 · TkA04G106070 · TK1151

Plastid0.033

Rank 3 · TkA04G106070 · TK1151

Cytoplasm0.031

Rank 4 · TkA04G106070 · TK1151

Mitochondrion0.023

Rank 5 · TkA04G106070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45040-490 aa

PF08446PAS_259-120 aa

PF08446PAS_2290-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G106070	`PF00067`	p450	40	490	2.3e-92	310.9
TkA04G106070	`PF08446`	PAS_2	59	120	0.32	12.5
TkA04G106070	`PF08446`	PAS_2	290	301	0.32	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card