Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1857 bp · TkA04G102880|TK1151|cDNA
TTTTGCCTTTATTTTTCGAAGGTAGCTTCTTCATTCCCTGTTCTTTCGGAAAAACCACACTTCTGCACGAACAGCGGAAGAGCTTAACAATGGCGGAGCCTAAGACCAAATACGATCGTCAGCTCAGGATCTGGGGTGAACAAGGGCAGGCTGCACTTGAGAAAGCTAGTATCTGTTTGCTTAATTGTGGCCCAACTGGTTCTGAAACTCTCAAAAACCTTGTTCTTGGTGGTATTGGAAGTATCACTGTTGTTGATGGT...
1338 bp · TkA04G102880|TK1151|CDS
ATGGCGGAGCCTAAGACCAAATACGATCGTCAGCTCAGGATCTGGGGTGAACAAGGGCAGGCTGCACTTGAGAAAGCTAGTATCTGTTTGCTTAATTGTGGCCCAACTGGTTCTGAAACTCTCAAAAACCTTGTTCTTGGTGGTATTGGAAGTATCACTGTTGTTGATGGTTCTAAAGTCGAAAATGGAGACCTTGGAAATAATTTCATGGTTAGCGAATCAAGTCTTGGACAGCCAAAGGCAAAATGTGTCTGTGCTTT...
Protein
Download Protein FASTA445 aa · TkA04G102880|TK1151|PROTEIN
MAEPKTKYDRQLRIWGEQGQAALEKASICLLNCGPTGSETLKNLVLGGIGSITVVDGSKVENGDLGNNFMVSESSLGQPKAKCVCAFLQELNDAVKAKFIEEHPVTLIETNPSFFSQFTVVIATQLVEDSMVKLDRICRDANVMVIFARSYGLTGFVRISVKEHAVIESKPDHFLDDLRLNNPWPELKKFTESVNLDIPDPVVHKHTPYILILVKMASEWAKTHGGKLPSTREEKKEFKELIKGKIIKDEDEDNYKEAIE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G102880 |
|---|---|
| TK1151 ID | TkA04G102880 |
| OH-1004 ID | LXL04_035848 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 98.700 |
| Protein coverage (%) | TK1151 89.438 / OH-1004 75.954Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G102880 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:26770097-26774199 (+) | |||||||||
| Description | Similar to AXR1: NEDD8-activating enzyme E1 regulatory subunit AXR1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0007131 reciprocal meiotic recombination Biological Process GO:0009414 response to water deprivation Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009735 response to cytokinin Biological Process GO:0009791 post-embryonic development Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0019954 asexual reproduction Biological Process GO:0033314 mitotic DNA replication checkpoint signaling Biological Process GO:0043326 chemotaxis to folate Biological Process GO:0043327 chemotaxis to cAMP Biological Process GO:0045116 protein neddylation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G05180 ath:AT2G32410 ddi:DDB_G0287965 mmu:234664 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00899ThiF8-162 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G102880 | PF00899 | ThiF | 8 | 162 | 2.1e-22 | 80.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.