TkA04G102620 | RubberDandelionOmics

Gene overview

TkA04G102620

Reference: TK1151 Chr: Chr04 Coordinates: 26679410-26681894 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · TkA04G102620|TK1151|cDNA

ATGAAGCACATCCATTCACTTAGAATCCACACTTGGTTTTTTGTCATTATTATTTTCGTGGTTCTTAGCCACGGTGGAAGTCTCCATCCACATCATTTCATATATAGAGAGAAGATGACCGATGGTGATCACCAAATTCATTGGCACCCCAAGGAACAAAAACACGAAGAATTGTATCCAACGGGGTCAAGCCTACCAGATTGCTCCCATGCTTGTGGTCCATGTTTTCCTTGTCGAAGAGTGATTATAGGCTACAAATG...

CDS

Download CDS FASTA

336 bp · TkA04G102620|TK1151|CDS

ATGAAGCACATCCATTCACTTAGAATCCACACTTGGTTTTTTGTCATTATTATTTTCGTGGTTCTTAGCCACGGTGGAAGTCTCCATCCACATCATTTCATATATAGAGAGAAGATGACCGATGGTGATCACCAAATTCATTGGCACCCCAAGGAACAAAAACACGAAGAATTGTATCCAACGGGGTCAAGCCTACCAGATTGCTCCCATGCTTGTGGTCCATGTTTTCCTTGTCGAAGAGTGATTATAGGCTACAAATG...

Protein

Download Protein FASTA

111 aa · TkA04G102620|TK1151|PROTEIN

MKHIHSLRIHTWFFVIIIFVVLSHGGSLHPHHFIYREKMTDGDHQIHWHPKEQKHEELYPTGSSLPDCSHACGPCFPCRRVIIGYKCPMTESCPVIYRCICRGRYYHVPTN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G102620`
TK1151 ID	TkA04G102620
OH-1004 ID	LXL04_035853
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.300
Protein coverage (%)	TK1151 100.000 / OH-1004 96.522 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G102620

Location Chr04:26679410-26681894 (+)

Description Similar to EPF2: Protein EPIDERMAL PATTERNING FACTOR 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34245`	Controls stomatal patterning.	Epidermal cell density is autoregulated via a secretory peptide, EPIDERMAL PATTERNING FACTOR 2 in Arabidopsis leaves.2009 · DOI: 10.1093/pcp/pcp068 The NMR structure of stomagen reveals the basis of stomatal density regulation by plant peptide hormones.2011 · DOI: 10.1038/ncomms1520 Direct interaction of ligand-receptor pairs specifying stomatal patterning.2012 · DOI: 10.1101/gad.179895.111 Carbonic anhydrases, EPF2 and a novel protease mediate CO2 control of stomatal development.2014 · DOI: 10.1038/nature13452
`At1g71866`	Controls stomatal patterning.	No verified direct reference in this release
`At2g20875`	Controls stomatal patterning.	The secretory peptide gene EPF1 enforces the stomatal one-cell-spacing rule.2007 · DOI: 10.1101/gad.1550707 Epidermal cell density is autoregulated via a secretory peptide, EPIDERMAL PATTERNING FACTOR 2 in Arabidopsis leaves.2009 · DOI: 10.1093/pcp/pcp068 The NMR structure of stomagen reveals the basis of stomatal density regulation by plant peptide hormones.2011 · DOI: 10.1038/ncomms1520 Direct interaction of ligand-receptor pairs specifying stomatal patterning.2012 · DOI: 10.1101/gad.179895.111 Carbonic anhydrases, EPF2 and a novel protease mediate CO2 control of stomatal development.2014 · DOI: 10.1038/nature13452

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035853 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010052 guard cell differentiation Biological Process

GO:0010374 stomatal complex development Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0090626 plant epidermis morphogenesis Biological Process

GO:2000122 negative regulation of stomatal complex development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0019901 protein kinase binding Molecular Function

KEGG gene cross-reference

ath:AT1G34245

ath:AT1G71866

ath:AT2G20875

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.627

Rank 1 · TkA04G102620 · TK1151

Cell membrane0.146

Rank 2 · TkA04G102620 · TK1151

Endoplasmic reticulum0.115

Rank 3 · TkA04G102620 · TK1151

Cytoplasm0.109

Rank 4 · TkA04G102620 · TK1151

Nucleus0.063

Rank 5 · TkA04G102620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17181EPF61-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G102620	`PF17181`	EPF	61	108	1.3e-11	45.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LC53`	Arabidopsis thaliana	sp\|Q8LC53\|EPF2_ARATH Protein EPIDERMAL PATTERNING FACTOR 2	70.900%	Swiss-Prot	Low
`C4B8C5`	Arabidopsis thaliana	sp\|C4B8C5\|EPFL7_ARATH EPIDERMAL PATTERNING FACTOR-like protein 7	58.000%	Swiss-Prot	Low
`Q8S8I4`	Arabidopsis thaliana	sp\|Q8S8I4\|EPF1_ARATH Protein EPIDERMAL PATTERNING FACTOR 1	51.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card