RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G102440
Reference: TK1151 Chr: Chr04 Coordinates: 26626425-26630099 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2581 bp · TkA04G102440|TK1151|cDNA

CTTAACACACATTCTGCATCCCCACTGCAACCTAACTGAGCAGAGAGCGTTGGGGGGTGGGGGTGGGGTTGGGGTAGGGTAGAACAAGCGAAAAGTTTGCAAAAAGGGGCACCTAAAGATACCACCCACTAGACAATTCAAGTTTCTTTTTGGTTTTTTCCTCTCATTATCCCTTTTCCTATGGGATCCGTCTTTTGTTTCTGACCTGTTGCTGTTTTTCCAGTTCGCAGTTGTAGTAATTTGAGCAATTTTGGGGTTTT...

CDS

Download CDS FASTA

1899 bp · TkA04G102440|TK1151|CDS

ATGCAGAGAGAATCGGTGATGTCGTTTGTGAGAGGGTTGATCGCGGCGGTTCTTGTTCTGGTTCTGGTTCTAGTTCATCATGTTGAGCTCGTGAATGCAAATGTGGAAGGCGATGCTTTACATAGTTTAAGAACCAACTTAGAAGATCCCAATAGCGTTCTTCAAAGCTGGGACCCCACTCTTGTTAACCCCTGCACCTGGTTTCATGTCACCTGCAATAACGATAACAGTGTTATAAGAGTAGATTTGGGAAATGCAGC...

Protein

Download Protein FASTA

632 aa · TkA04G102440|TK1151|PROTEIN

MQRESVMSFVRGLIAAVLVLVLVLVHHVELVNANVEGDALHSLRTNLEDPNSVLQSWDPTLVNPCTWFHVTCNNDNSVIRVDLGNAALSGTLVPQLGLLKNLQYLELYSNNLSGPIPSDLGNLTNLVSLDLYLNDFSGPIPVTLGKLSKLRFLRLNNNSLTGPIPLPLTNITSLQVLDLSNNRLSGPVPDSGSFSLFTPISFANNLDLCGPVTGHPCPGSPPFSPPPPFVQPPPIAAPVGKSGTGAIAGGVAVGAALLFA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G102440
TK1151 IDTkA04G102440
OH-1004 IDLXL04_035857
Relationship / confidenceMulti Candidate From Tk1151 / Complex relationship
Protein identity (%)93.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G102440
LocationChr04:26626425-26630099 (+)
DescriptionSimilar to SERK1: Somatic embryogenesis receptor kinase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g71830 Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.
Role of threonines in the Arabidopsis thaliana somatic embryogenesis receptor kinase 1 activation loop in phosphorylation.2001 · DOI: 10.1074/jbc.m102381200
In vivo hexamerization and characterization of the Arabidopsis AAA ATPase CDC48A complex using forster resonance energy transfer-fluorescence lifetime imaging microscopy and fluorescence correlation spectroscopy.2007 · DOI: 10.1104/pp.107.103986
At1g34210 Serine/threonine-kinase involved in brassinosteroid-dependent and -independent signaling pathways.
Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8BB68 LRR receptor kinase involved in defense response. No verified direct reference in this release
Os08g0174700 LRR receptor kinase involved in defense response.
Engineering OsBAK1 gene as a molecular tool to improve rice architecture for high yield.2009 · DOI: 10.1111/j.1467-7652.2009.00444.x
A subset of OsSERK genes, including OsBAK1, affects normal growth and leaf development of rice.2011 · DOI: 10.1007/s10059-011-0178-4
Os04g0457800 LRR receptor kinase involved in positive regulation of somatic embryogenesis and defense response against the rice blast fungus pathogen Magnaporthe oryzae.
Rice SERK1 gene positively regulates somatic embryogenesis of cultured cell and host defense response against fungal infection.2005 · DOI: 10.1007/s00425-005-1534-4
An XA21-associated kinase (OsSERK2) regulates immunity mediated by the XA21 and XA3 immune receptors.2014 · DOI: 10.1093/mp/ssu003
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035857 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0006952 defense response Biological Process
GO:0007030 Golgi organization Biological Process
GO:0009556 microsporogenesis Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0010152 pollen maturation Biological Process
GO:0010227 floral organ abscission Biological Process
GO:0010262 somatic embryogenesis Biological Process
GO:0030154 cell differentiation Biological Process
GO:0040008 regulation of growth Biological Process
GO:0045089 positive regulation of innate immune response Biological Process
KEGG gene cross-reference
ath:AT1G34210
ath:AT1G71830
dosa:Os04g0457800
dosa:Os08g0174700
osa:4336035
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.883
Rank 1 · TkA04G102440 · TK1151
Endoplasmic reticulum0.076
Rank 2 · TkA04G102440 · TK1151
Cytoplasm0.073
Rank 3 · TkA04G102440 · TK1151
Nucleus0.048
Rank 4 · TkA04G102440 · TK1151
Lysosome / Vacuole0.021
Rank 5 · TkA04G102440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_234-73 aa
PF00560LRR_180-97 aa
PF23598LRR_1489-181 aa
PF13855LRR_899-135 aa
PF12799LRR_4100-136 aa
PF13516LRR_6100-114 aa
PF00560LRR_1101-123 aa
PF23211LRR_LRWD1101-162 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G102440PF08263LRRNT_234733.9e-1040.5
TkA04G102440PF00560LRR_180973.1e-1244.8
TkA04G102440PF23598LRR_14891817.5e-0935.5
TkA04G102440PF13855LRR_8991353.4e-0524.2
TkA04G102440PF12799LRR_41001362.6e-1040.9
TkA04G102440PF13516LRR_61001140.8810.5
TkA04G102440PF00560LRR_11011233.1e-1244.8
TkA04G102440PF23211LRR_LRWD11011620.001718.8
TkA04G102440PF13516LRR_61231370.8810.5
TkA04G102440PF00560LRR_11251473.1e-1244.8
TkA04G102440PF13855LRR_81441843.4e-0524.2
TkA04G102440PF13516LRR_61481620.8810.5
TkA04G102440PF00560LRR_11491703.1e-1244.8
TkA04G102440PF12799LRR_41491842.6e-1040.9
TkA04G102440PF13516LRR_61721850.8810.5
TkA04G102440PF00560LRR_11731913.1e-1244.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q94AG2Arabidopsis thalianasp|Q94AG2|SERK1_ARATH Somatic embryogenesis receptor kinase 190.900%Swiss-ProtHigh
Q9XIC7Arabidopsis thalianasp|Q9XIC7|SERK2_ARATH Somatic embryogenesis receptor kinase 289.400%Swiss-ProtHigh
B8BB68Oryza sativa subsp. indicasp|B8BB68|BAK1_ORYSI LRR receptor kinase BAK191.300%Swiss-ProtHigh
Q6Z4U4Oryza sativa subsp. japonicasp|Q6Z4U4|BAK1_ORYSJ LRR receptor kinase BAK191.300%Swiss-ProtHigh
Q7XV05Oryza sativa subsp. japonicasp|Q7XV05|SERK2_ORYSJ LRR receptor kinase SERK289.200%Swiss-ProtHigh

JBrowse

View in Genome Browser