TkA04G102220 | RubberDandelionOmics

Gene overview

TkA04G102220

Reference: TK1151 Chr: Chr04 Coordinates: 26562843-26567419 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1959 bp · TkA04G102220|TK1151|cDNA

AAAAACCTGAATTTCGACGACCGGCCACAAGCTAGCAGCAGCCTTTGTCTTCTTTAACATACTATAAATACATGCACCCAATTCATGCAAATACATAACTTAAACTTGAAAGAAGCCACTTGTAGGTTTATGATTAATTACACCATTAGTCAATAAGATGAAAATGAGTTTCCAAGCTCTAGGGTTTCTTCTCATTCTTTCATTCGTTCATTTACAAGCTGCCACCCTTCGATACACATTTGTGATACAAGAAACGAACT...

CDS

Download CDS FASTA

1698 bp · TkA04G102220|TK1151|CDS

ATGAAAATGAGTTTCCAAGCTCTAGGGTTTCTTCTCATTCTTTCATTCGTTCATTTACAAGCTGCCACCCTTCGATACACATTTGTGATACAAGAAACGAACTACACGAGGCTATGCAGTAGCAAGAACATCTTAACAGTTAATGGAGAATTTCCAGGTCCAACAATCAGAGCTCGGAGAGGCGACACTGTCATCGTTGACGTTATCAACAGGGGCGACTACAATATCACAATCCATTGGCATGGAGTGAAACAACCACG...

Protein

Download Protein FASTA

565 aa · TkA04G102220|TK1151|PROTEIN

MKMSFQALGFLLILSFVHLQAATLRYTFVIQETNYTRLCSSKNILTVNGEFPGPTIRARRGDTVIVDVINRGDYNITIHWHGVKQPRYPWSDGPEFVTQCPIQPGANFSQRVLLSDEEGTLWWHAHSDWSRATVHGLFVILPRMGTTYPFPKPDAEIPVVLGEWWQNDIQTVFEDFFDGGGDPASSDALMINGQPGDLYNCSTSGTTKIKIDKGKTYMLRMVNAVMNNLVFFAIANHSLTVVGGDGAYTKPLTSNYVTIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G102220`
TK1151 ID	TkA04G102220
OH-1004 ID	LXL04_035860
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 99.823 / OH-1004 79.549 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G102220

Location Chr04:26562843-26567419 (-)

Description Similar to LAC14: Laccase-14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09360`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release
`At5g48100`	Lignin degradation and detoxification of lignin-derived products (By similarity).	TRANSPARENT TESTA10 encodes a laccase-like enzyme involved in oxidative polymerization of flavonoids in Arabidopsis seed coat.2005 · DOI: 10.1105/tpc.105.035154 Involvement of AtLAC15 in lignin synthesis in seeds and in root elongation of Arabidopsis.2006 · DOI: 10.1007/s00425-006-0300-6 Mutant identification and characterization of the laccase gene family in Arabidopsis.2006 · DOI: 10.1093/jxb/erl022

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0749700`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release
`Os11g0696900`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release
`Os01g0374600`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035860 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009809 lignin biosynthetic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0010023 proanthocyanidin biosynthetic process Biological Process

GO:0046274 lignin catabolic process Biological Process

GO:0046688 response to copper ion Biological Process

GO:0005576 extracellular region Cellular Component

GO:0048046 apoplast Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0052716 hydroquinone:oxygen oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT5G09360

ath:AT5G48100

dosa:Os01g0374600

dosa:Os11g0696900

osa:107276196

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.772

Rank 1 · TkA04G102220 · TK1151

Cell membrane0.083

Rank 2 · TkA04G102220 · TK1151

Cytoplasm0.061

Rank 3 · TkA04G102220 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA04G102220 · TK1151

Golgi apparatus0.031

Rank 5 · TkA04G102220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07732Cu-oxidase_330-143 aa

PF07731Cu-oxidase_252-84 aa

PF00394Cu-oxidase157-305 aa

PF07732Cu-oxidase_3208-280 aa

PF07731Cu-oxidase_2237-274 aa

PF07731Cu-oxidase_2415-548 aa

PF00394Cu-oxidase459-529 aa

PF07732Cu-oxidase_3510-547 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G102220	`PF07732`	Cu-oxidase_3	30	143	4.2e-43	146.9
TkA04G102220	`PF07731`	Cu-oxidase_2	52	84	4.9e-43	146.9
TkA04G102220	`PF00394`	Cu-oxidase	157	305	8.6e-41	140.4
TkA04G102220	`PF07732`	Cu-oxidase_3	208	280	4.2e-43	146.9
TkA04G102220	`PF07731`	Cu-oxidase_2	237	274	4.9e-43	146.9
TkA04G102220	`PF07731`	Cu-oxidase_2	415	548	4.9e-43	146.9
TkA04G102220	`PF00394`	Cu-oxidase	459	529	8.6e-41	140.4
TkA04G102220	`PF07732`	Cu-oxidase_3	510	547	4.2e-43	146.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FY79`	Arabidopsis thaliana	sp\|Q9FY79\|LAC14_ARATH Laccase-14	52.900%	Swiss-Prot	High
`Q84J37`	Arabidopsis thaliana	sp\|Q84J37\|LAC15_ARATH Laccase-15	53.000%	Swiss-Prot	High
`Q6Z8L2`	Oryza sativa subsp. japonica	sp\|Q6Z8L2\|LAC9_ORYSJ Putative laccase-9	53.600%	Swiss-Prot	High
`Q2QZ80`	Oryza sativa subsp. japonica	sp\|Q2QZ80\|LAC21_ORYSJ Laccase-21	52.300%	Swiss-Prot	High
`Q5ZCW1`	Oryza sativa subsp. japonica	sp\|Q5ZCW1\|LAC1_ORYSJ Putative laccase-1	51.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card