TkA04G098890 | RubberDandelionOmics

Gene overview

TkA04G098890

Reference: TK1151 Chr: Chr04 Coordinates: 25783829-25784359 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

531 bp · TkA04G098890|TK1151|cDNA

ATGGCCCCTTTCTCCTTCCCAAAAATCTTTCTCTTTTTCTCCATAACTTTGCTGTCCGCCATCTCCAATGCCCAGCCTTCTCCACCATACGCGCTCGTTAACAAAGTTTGCAGCAAACAAGACAACGTTAATCTCTGCTTACAGGTCCTAAAATCCGATAGCCGGAGCCAATTTGCAGATAAAATCACCATCCTTACAAAGATCGCGGTTGAATATACAACAAAAAACGCAACCACCACTCGCGATTACTTCCGCAGCGT...

CDS

Download CDS FASTA

531 bp · TkA04G098890|TK1151|CDS

ATGGCCCCTTTCTCCTTCCCAAAAATCTTTCTCTTTTTCTCCATAACTTTGCTGTCCGCCATCTCCAATGCCCAGCCTTCTCCACCATACGCGCTCGTTAACAAAGTTTGCAGCAAACAAGACAACGTTAATCTCTGCTTACAGGTCCTAAAATCCGATAGCCGGAGCCAATTTGCAGATAAAATCACCATCCTTACAAAGATCGCGGTTGAATATACAACAAAAAACGCAACCACCACTCGCGATTACTTCCGCAGCGT...

Protein

Download Protein FASTA

176 aa · TkA04G098890|TK1151|PROTEIN

MAPFSFPKIFLFFSITLLSAISNAQPSPPYALVNKVCSKQDNVNLCLQVLKSDSRSQFADKITILTKIAVEYTTKNATTTRDYFRSVKSGPPGVLKSLVDCIEAYNSAITSLQVSMREEDCSLTGYDIHSAGDEVQRCQSIADSNGAHGSFITSRNTVTQSVCRLSESLANLMCDN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G098890`
TK1151 ID	TkA04G098890
OH-1004 ID	LXL04_009217
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	29.700
Protein coverage (%)	TK1151 61.364 / OH-1004 69.091 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G098890`
Location	Chr04:25783829-25784359 (+)
Description	Similar to C/VIF2: Cell wall / vacuolar inhibitor of fructosidase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009217` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009555 pollen development Biological Process GO:0009827 plant-type cell wall modification Biological Process GO:0009846 pollen germination Biological Process GO:0043086 negative regulation of catalytic activity Biological Process GO:0005576 extracellular region Cellular Component GO:0005773 vacuole Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009507 chloroplast Cellular Component GO:0043667 pollen wall Cellular Component GO:0048046 apoplast Cellular Component GO:0004857 enzyme inhibitor activity Molecular Function
KEGG gene cross-reference	ath:AT1G47960 ath:AT5G64620 dosa:Os08g0108100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.513

Rank 1 · TkA04G098890 · TK1151

Endoplasmic reticulum0.173

Rank 2 · TkA04G098890 · TK1151

Cytoplasm0.137

Rank 3 · TkA04G098890 · TK1151

Lysosome / Vacuole0.107

Rank 4 · TkA04G098890 · TK1151

Cell membrane0.090

Rank 5 · TkA04G098890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04043PMEI32-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G098890	`PF04043`	PMEI	32	118	4e-12	47.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card