TkA04G098780 | RubberDandelionOmics

Gene overview

TkA04G098780

Reference: TK1151 Chr: Chr04 Coordinates: 25758639-25760406 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1558 bp · TkA04G098780|TK1151|cDNA

TGTTAACCTCAAAAAGTTTCTAAGATTTTGAATCATCTGAAGTTATTTGGATATATCTTTCTTTTTTGTCCTATCCCAATCTAGAATATTTCATCTTTCTTGTGTTATTTCATGTTGGTTTTAAAGGTGGCGAACCCAAGAGATTCAGATAAGTATTTCACCTCTCACAACGATGAAGGAGGCGGAGTAGGTAGAGCTGCACCACAACAACCCTCGCCGCGTTTGAAGTTTCTCCCGGAGATGTTTTCATCGGAGTTTAG...

CDS

Download CDS FASTA

1098 bp · TkA04G098780|TK1151|CDS

ATGTTGGTTTTAAAGGTGGCGAACCCAAGAGATTCAGATAAGTATTTCACCTCTCACAACGATGAAGGAGGCGGAGTAGGTAGAGCTGCACCACAACAACCCTCGCCGCGTTTGAAGTTTCTCCCGGAGATGTTTTCATCGGAGTTTAGTTATTCACAGGAGATGTCTGCTATGGTGACGGCGTTAACTCATGTGGTTTCCGGACATACATCTGGCAGTCCCGATGTTGGTGTTTCTCCGTCGGTTCGTGGCGGCGCTGG...

Protein

Download Protein FASTA

365 aa · TkA04G098780|TK1151|PROTEIN

MLVLKVANPRDSDKYFTSHNDEGGGVGRAAPQQPSPRLKFLPEMFSSEFSYSQEMSAMVTALTHVVSGHTSGSPDVGVSPSVRGGAGGVFSTDSPSSAYSSSSSGSLSLVGNKRVREQDQSVNQLSEQHYRMFYEGREDEFPSTATTTTVVDAVIHHNPTTVANQQEDTGERRRKYRGVRQRPWGKWAAEIRDPQKAARVWLGTFDTAEAAARAYDEAALRFRGNKAKLNFPENATLLPPQQLTHPTAIVRHPPPLQPLY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G098780`
TK1151 ID	TkA04G098780
OH-1004 ID	LXL04_035890
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G098780

Location Chr04:25758639-25760406 (+)

Description Similar to ERF114: Ethylene-responsive transcription factor ERF114

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50080`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g64750`	Negative regulator of the abscisic acid (ABA) signaling pathway involved in seed germination and in responses to stress conditions.	ABR1, an APETALA2-domain transcription factor that functions as a repressor of ABA response in Arabidopsis.2005 · DOI: 10.1104/pp.105.066324
`At1g43160`	Transcriptional activator involved in the regulation of plant development and tolerance to abiotic stresses.	Functional characterization of four APETALA2-family genes (RAP2.6, RAP2.6L, DREB19 and DREB26) in Arabidopsis.2011 · DOI: 10.1007/s11103-010-9711-7
`At5g07310`	Acts as a transcriptional activator of the phytosulfokine PSK5 peptide hormone.	No verified direct reference in this release
`At2g33710`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035890 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009625 response to insect Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0034059 response to anoxia Biological Process

KEGG gene cross-reference

ath:AT2G33710

ath:AT2G47520

ath:AT5G13330

ath:AT5G50080

ath:AT5G61890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · TkA04G098780 · TK1151

Cytoplasm0.083

Rank 2 · TkA04G098780 · TK1151

Cell membrane0.026

Rank 3 · TkA04G098780 · TK1151

Endoplasmic reticulum0.023

Rank 4 · TkA04G098780 · TK1151

Plastid0.015

Rank 5 · TkA04G098780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP2175-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G098780	`PF00847`	AP2	175	224	1.8e-15	57.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q70II3`	Arabidopsis thaliana	sp\|Q70II3\|EF110_ARATH Ethylene-responsive transcription factor ERF110	59.700%	Swiss-Prot	Low
`Q9FGF8`	Arabidopsis thaliana	sp\|Q9FGF8\|ABR1_ARATH Ethylene-responsive transcription factor ABR1	78.300%	Swiss-Prot	Low
`Q7G1L2`	Arabidopsis thaliana	sp\|Q7G1L2\|RAP26_ARATH Ethylene-responsive transcription factor RAP2-6	78.700%	Swiss-Prot	Low
`Q9LY29`	Arabidopsis thaliana	sp\|Q9LY29\|EF115_ARATH Ethylene-responsive transcription factor ERF115	84.800%	Swiss-Prot	Low
`P93007`	Arabidopsis thaliana	sp\|P93007\|EF112_ARATH Ethylene-responsive transcription factor ERF112	66.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card