TkA04G096790 | RubberDandelionOmics

Gene overview

TkA04G096790

Reference: TK1151 Chr: Chr04 Coordinates: 25217119-25218375 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1224 bp · TkA04G096790|TK1151|cDNA

ATGGACTCAACAAAATTGAAGCGTTTGAGATTATTTGGAATTCGTTTAGGTTCTACACTCTCCAAAACTTTGTTCTTAATCGTAACCGTTTTGTTCATCCGCACCCTTTTCCTTCCCGATTCCTTCAGATTTGGATCCCATTCCGGAAACCCCAAGACAAGGTTCTTAGAGGTACCCCAGATCGTATGGGGATTAAACAACCAAAAAATCGCCTTCGCAAGAGCTTGTTTAACCGCAAGGTTACTAAACAGAACCCTTCT...

CDS

Download CDS FASTA

1224 bp · TkA04G096790|TK1151|CDS

ATGGACTCAACAAAATTGAAGCGTTTGAGATTATTTGGAATTCGTTTAGGTTCTACACTCTCCAAAACTTTGTTCTTAATCGTAACCGTTTTGTTCATCCGCACCCTTTTCCTTCCCGATTCCTTCAGATTTGGATCCCATTCCGGAAACCCCAAGACAAGGTTCTTAGAGGTACCCCAGATCGTATGGGGATTAAACAACCAAAAAATCGCCTTCGCAAGAGCTTGTTTAACCGCAAGGTTACTAAACAGAACCCTTCT...

Protein

Download Protein FASTA

407 aa · TkA04G096790|TK1151|PROTEIN

MDSTKLKRLRLFGIRLGSTLSKTLFLIVTVLFIRTLFLPDSFRFGSHSGNPKTRFLEVPQIVWGLNNQKIAFARACLTARLLNRTLLMPSLSASLFYKEIDKLQPISFHKVFQFEKFNSLCKNFIQLGRYSDIHNHSDIVTIQKGSGRRWTSERDLDQLNTLKTHKSETIRLSGKNPFLWHDHWPVTDYANVFECLVLVDEISKEADKVVAKITEFGSKYNNPVPYVAVHMRIEKDWMIHCKKREQRSNISDICSNKNEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G096790`
TK1151 ID	TkA04G096790
OH-1004 ID	LXL04_035916
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 98.585 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G096790

Location Chr04:25217119-25218375 (-)

Description Similar to OFUT23: O-fucosyltransferase 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05320`	Probable protein O-fucosyltransferase required for correct pollen tube penetration through the stigma-style interface.	A Putative Protein O -Fucosyltransferase Facilitates Pollen Tube Penetration through the Stigma - Style Interface.2018 · DOI: 10.1104/pp.17.01577

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035916 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0009856 pollination Biological Process

GO:0009875 pollen-pistil interaction Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G05320

ath:AT3G26370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.794

Rank 1 · TkA04G096790 · TK1151

Endoplasmic reticulum0.094

Rank 2 · TkA04G096790 · TK1151

Cytoplasm0.055

Rank 3 · TkA04G096790 · TK1151

Cell membrane0.049

Rank 4 · TkA04G096790 · TK1151

Extracellular0.041

Rank 5 · TkA04G096790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10250O-FucT64-351 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G096790	`PF10250`	O-FucT	64	351	2.3e-25	90.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA87`	Arabidopsis thaliana	sp\|Q9MA87\|OFT23_ARATH O-fucosyltransferase 23	60.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card