TkA04G096390 | RubberDandelionOmics

Gene overview

TkA04G096390

Reference: TK1151 Chr: Chr04 Coordinates: 25106421-25108127 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1625 bp · TkA04G096390|TK1151|cDNA

TTTGGAAAATGGCTACAAAATGCAAGTCCGGCGTTTAAGCACGTCCTCGGTTGGTGGTGCCTCCATCTGAAAAGCTTACAAATACACCAAAAACCAAATCGATAAAGCTTAACTACTCTCCAATGGAAAATCCCAATTCTAAATCACTCTCCCTCACACATTCAATTTCCCCGCATTCACACTCCGATTTCAATTCGCTCTTCACCCATATCAACACCGTTATCTTGTCGTCACCATCATCATCTCTGCAACCCTCAAGG...

CDS

Download CDS FASTA

660 bp · TkA04G096390|TK1151|CDS

ATGTACTTCGGGACCTGCGAGTTCGGTAAATCGGTGTTGTCGAAACTACCGAATTACCCAGCTGTTCTAATCCCTCCAACAGCTGGAGCAATGGGTAACATAATCTCTTCGGCTATCATGGTGCCGAAAGAGTTAATCACCCAACAAATGCAAGCAGGGGCGAAAGGGAGATCGTGGGAGGTTCTGTTACGGATATTGGAGAAAGATGGAGTTCTAGGTCTATACGCAGGTTACTCAGCGACATTGTTAAGAAACCTCCC...

Protein

Download Protein FASTA

219 aa · TkA04G096390|TK1151|PROTEIN

MYFGTCEFGKSVLSKLPNYPAVLIPPTAGAMGNIISSAIMVPKELITQQMQAGAKGRSWEVLLRILEKDGVLGLYAGYSATLLRNLPAGVLSYSSFEYLKAALLSKTKQPNLEAFQSVCCGALAGAISASLTTPLDVMKTRLMTQIHSEKAYGVSEIVKQILKEEGWVGFTRGMGPRVLHSACFSALGYFAFETARLTILHEYLRRKELDLATGVVNST

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G096390`
TK1151 ID	TkA04G096390
OH-1004 ID	LXL04_022108
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	37.200
Protein coverage (%)	TK1151 81.735 / OH-1004 54.407 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G096390

Location Chr04:25106421-25108127 (-)

Description Similar to SAMC1: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42130`	Probably involved in iron transport into chloroplasts.	Identification of an Arabidopsis mitoferrinlike carrier protein involved in Fe metabolism.2011 · DOI: 10.1016/j.plaphy.2011.02.003
`At1g34065`	Probable S-adenosylmethionine (SAM) transporter able to catalyze both uniport and exchange reactions through membranes.	No verified direct reference in this release
`At4g39460`	Transporter involved in exchange reactions through membranes.	Molecular identification of an Arabidopsis S-adenosylmethionine transporter. Analysis of organ distribution, bacterial expression, reconstitution into liposomes, and functional characterization.2006 · DOI: 10.1104/pp.106.086975 Arabidopsis SAMT1 defines a plastid transporter regulating plastid biogenesis and plant development.2006 · DOI: 10.1105/tpc.105.040741

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022108 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0015805 S-adenosyl-L-methionine transport Biological Process

GO:1990543 mitochondrial S-adenosyl-L-methionine transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0000095 S-adenosyl-L-methionine transmembrane transporter activity Molecular Function

GO:0180003 S-adenosyl-L-methionine:S-adenosyl-L-homocysteine antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G34065

ath:AT4G39460

dre:560478

sce:YNL003C

spo:2542695

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.824

Rank 1 · TkA04G096390 · TK1151

Plastid0.052

Rank 2 · TkA04G096390 · TK1151

Cytoplasm0.036

Rank 3 · TkA04G096390 · TK1151

Peroxisome0.023

Rank 4 · TkA04G096390 · TK1151

Cell membrane0.021

Rank 5 · TkA04G096390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr27-105 aa

PF00153Mito_carr112-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G096390	`PF00153`	Mito_carr	27	105	2.5e-35	120.8
TkA04G096390	`PF00153`	Mito_carr	112	199	2.5e-35	120.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHX2`	Arabidopsis thaliana	sp\|Q9FHX2\|MFL1_ARATH Protein MITOFERRINLIKE 1, chloroplastic	78.800%	Swiss-Prot	High
`F4HT41`	Arabidopsis thaliana	sp\|F4HT41\|SAMC2_ARATH Probable S-adenosylmethionine carrier 2, chloroplastic	39.400%	Swiss-Prot	Medium
`Q94AG6`	Arabidopsis thaliana	sp\|Q94AG6\|SAMC1_ARATH S-adenosylmethionine carrier 1, chloroplastic/mitochondrial	34.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card