TkA04G095110 | RubberDandelionOmics

Gene overview

TkA04G095110

Reference: TK1151 Chr: Chr04 Coordinates: 24764968-24770849 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3588 bp · TkA04G095110|TK1151|cDNA

ATTCCATCCTCATTTTGGGAAATATAAATGTAACGTAAATAGTAAATACACGGATGAGTGTACAATAAATAAAAACAATGGGTATCGTAGTCCGGCGATCTTGCACCTACCCTTTCAAACACCCAAAGAACGAAAACCTCAGTAAATTTAGAGAAGATCAGTCAACAGTCAACACCAATCCACTCTTCCCTTCAAGAAATATGCCGTAGTTCATCTTCGTATTTTAACGGCCCAAACGGAAGCAATAAATAAATAAACCA...

CDS

Download CDS FASTA

2874 bp · TkA04G095110|TK1151|CDS

ATGTTGGGGTTCAAGTTCGAATCATGTGCTAGATTGAAGATGATGGGGTTTAAATTCAAATCACGCGGGGGTGTTTTTGCTCTGATAATCCAATTATTGGTGACGATTTCAGTTGCGAAAGTTACCGATCCTTCTGAAGTCTCTGCATTGATTGCGGTGAGAGGTAGTTTAGTTGATCCAATGAATCATCTTAGAAACTGGAATAAAGGGGATCCATGCACATCAAATTGGACGGGAGTTATATGTGTTCATAAAACCAG...

Protein

Download Protein FASTA

957 aa · TkA04G095110|TK1151|PROTEIN

MLGFKFESCARLKMMGFKFKSRGGVFALIIQLLVTISVAKVTDPSEVSALIAVRGSLVDPMNHLRNWNKGDPCTSNWTGVICVHKTSVDKYWHVQELQLLNMNLSGSLAPELGQFPHLKILDFMWNDVSGNIPKEIGNLSSLVLLLLNGNKLTGNLPDELGYLRNLDRFQIDQNHISGPIPKSFSNLNSIKHIHFNNNSLSGQIPEELSNLSTLMHLLLDNNNLSGYLPSEFGNFPNMRIVQLDNNDFNGTEIPASYGNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G095110`
TK1151 ID	TkA04G095110
OH-1004 ID	LXL04_035938
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G095110

Location Chr04:24764968-24770849 (+)

Description Similar to At1g06840: Probable LRR receptor-like serine/threonine-protein kinase At1g06840

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06840`	Probable LRR receptor-like serine/threonine-protein kinase At1g06840.	No verified direct reference in this release
`At3g53590`	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590.	No verified direct reference in this release
`At5g37450`	Probable LRR receptor-like serine/threonine-protein kinase At5g37450.	No verified direct reference in this release
`At5g49760`	Leucine-rich repeat receptor protein kinase that acts as sensor of extracellular hydrogen peroxide.	Hydrogen peroxide sensor HPCA1 is an LRR receptor kinase in Arabidopsis.2020 · DOI: 10.1038/s41586-020-2032-3
`At5g49770`	Probable leucine-rich repeat receptor-like protein kinase At5g49770.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035938 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009593 detection of chemical stimulus Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G06840

ath:AT5G37450

ath:AT5G49760

ath:AT5G49770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.830

Rank 1 · TkA04G095110 · TK1151

Endoplasmic reticulum0.086

Rank 2 · TkA04G095110 · TK1151

Cytoplasm0.071

Rank 3 · TkA04G095110 · TK1151

Lysosome / Vacuole0.045

Rank 4 · TkA04G095110 · TK1151

Nucleus0.040

Rank 5 · TkA04G095110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_244-82 aa

PF25019LRR_R13L1-DRL2193-122 aa

PF00560LRR_194-114 aa

PF12799LRR_494-131 aa

PF23598LRR_14105-364 aa

PF13855LRR_8105-152 aa

PF00560LRR_1117-139 aa

PF23286LRR_13120-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G095110	`PF08263`	LRRNT_2	44	82	1.2e-10	42.2
TkA04G095110	`PF25019`	LRR_R13L1-DRL21	93	122	2.5e-06	28.1
TkA04G095110	`PF00560`	LRR_1	94	114	2e-15	54.3
TkA04G095110	`PF12799`	LRR_4	94	131	7.2e-08	33.1
TkA04G095110	`PF23598`	LRR_14	105	364	3.7e-15	56.3
TkA04G095110	`PF13855`	LRR_8	105	152	1.9e-12	47.5
TkA04G095110	`PF00560`	LRR_1	117	139	2e-15	54.3
TkA04G095110	`PF23286`	LRR_13	120	172	0.076	13.4
TkA04G095110	`PF29252`	LRR_NLRC4	136	173	4.0	7.3
TkA04G095110	`PF00560`	LRR_1	141	163	2e-15	54.3
TkA04G095110	`PF12799`	LRR_4	141	176	7.2e-08	33.1
TkA04G095110	`PF25019`	LRR_R13L1-DRL21	159	220	2.5e-06	28.1
TkA04G095110	`PF13855`	LRR_8	164	224	1.9e-12	47.5
TkA04G095110	`PF00560`	LRR_1	165	187	2e-15	54.3
TkA04G095110	`PF23286`	LRR_13	183	240	0.076	13.4
TkA04G095110	`PF29252`	LRR_NLRC4	183	224	4.0	7.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGD7`	Arabidopsis thaliana	sp\|C0LGD7\|Y1684_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g06840	59.700%	Swiss-Prot	High
`Q9LFG1`	Arabidopsis thaliana	sp\|Q9LFG1\|Y3359_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590	59.700%	Swiss-Prot	High
`C0LGU1`	Arabidopsis thaliana	sp\|C0LGU1\|Y5374_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g37450	56.000%	Swiss-Prot	High
`Q8GZ99`	Arabidopsis thaliana	sp\|Q8GZ99\|HPCA1_ARATH Leucine-rich repeat receptor protein kinase HPCA1	36.100%	Swiss-Prot	Medium
`Q9LT96`	Arabidopsis thaliana	sp\|Q9LT96\|Y5977_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g49770	37.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card