TkA04G094440 | RubberDandelionOmics

Gene overview

TkA04G094440

Reference: TK1151 Chr: Chr04 Coordinates: 24591607-24594054 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1332 bp · TkA04G094440|TK1151|cDNA

AGGACATGTCCTCTCAATTGGCTATTATATATATATATATATATATATATATTGGTATTTTTAGGGAAAAGAAAATATCTTGGCTGAAAACTTAGCGCACGTCGTCGTCGTTCCCTTCTGACCTAACTTAGCAAGTCTCTTCTTCCTTGGGCCCTAACTTAGCCTTAGCCGGAGATGGAATTGAAGCAGCTTTGGCTCCGGAATTTTTCACTGATTTGGAATCAAGGTTCGGTCCTTCCTCTCGGTCCATAGGTTTCGAC...

CDS

Download CDS FASTA

795 bp · TkA04G094440|TK1151|CDS

ATGTCTGCTACATATCGTGGCAATCTCTTACGACGACATACACCTATAATGAAAGGTAGGCTGAAGATTGAAGGACAGCATCTAGATGTTGCTGTATACGCCCTTGGAATTGGAGCATGTGGCAAAGATGCTTTAGATGATAAGGAGCTCAAATATGTGTACCATGAAAATGGGCAGCAGTCCATCCAGGTACTTCCAACATTTGCAGCTTTATTTTCCATTGGACTTATTGACAAACTAGAGCAGTTGCCAGGATTTAC...

Protein

Download Protein FASTA

264 aa · TkA04G094440|TK1151|PROTEIN

MSATYRGNLLRRHTPIMKGRLKIEGQHLDVAVYALGIGACGKDALDDKELKYVYHENGQQSIQVLPTFAALFSIGLIDKLEQLPGFTFDPCLLLHGQQYIEICKPLPSSCSMQNKTSIVGLHDKGKAAILEFEVLSYEKETSEPLSRNRSTVYLRGAGGFSKSSQPYSFSKYPKDQTSSKTPKTPPFAIHEETLQPSQVCKFGNVRIQDFLRMFEFIDVGKNGEIIFKEFSVGSAHIVNQPLFHQACELAFVTLIKIFTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G094440`
TK1151 ID	TkA04G094440
OH-1004 ID	LXL04_015175
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.000
Protein coverage (%)	TK1151 65.909 / OH-1004 56.494 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G094440

Location Chr04:24591607-24594054 (-)

Description Similar to ECH2: Enoyl-CoA hydratase 2, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76150`	Bidirectional monofunctional enoyl-CoA hydratase 2 involved in the degradation of even cis-unsaturated fatty acids.	Identification and functional characterization of a monofunctional peroxisomal enoyl-CoA hydratase 2 that participates in the degradation of even cis-unsaturated fatty acids in Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m606383200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015175 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0008209 androgen metabolic process Biological Process

GO:0008210 estrogen metabolic process Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase Biological Process

GO:0033542 fatty acid beta-oxidation, unsaturated, even number Biological Process

GO:0036111 very long-chain fatty-acyl-CoA metabolic process Biological Process

GO:0036112 medium-chain fatty-acyl-CoA metabolic process Biological Process

GO:0048545 response to steroid hormone Biological Process

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G76150

hsa:3295

mmu:15488

ncr:NCU08828

rno:79244

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.443

Rank 1 · TkA04G094440 · TK1151

Mitochondrion0.330

Rank 2 · TkA04G094440 · TK1151

Cytoplasm0.122

Rank 3 · TkA04G094440 · TK1151

Plastid0.078

Rank 4 · TkA04G094440 · TK1151

Nucleus0.053

Rank 5 · TkA04G094440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22622MFE-2_hydrat-2_N27-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G094440	`PF22622`	MFE-2_hydrat-2_N	27	156	1.8e-33	115.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYI3`	Arabidopsis thaliana	sp\|Q8VYI3\|ECH2_ARATH Enoyl-CoA hydratase 2, peroxisomal	60.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card