TkA04G094040 | RubberDandelionOmics

Gene overview

TkA04G094040

Reference: TK1151 Chr: Chr04 Coordinates: 24466435-24468230 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1324 bp · TkA04G094040|TK1151|cDNA

CTTATACTTCATTGTAAACCATATATTAATAAATGAAATCTAGTGTTTCTAAGTCATATCTTTCCAGTTTTTCCGGTTTATAAATCTCTGGAGTTAATGTGATCATAGACTCCTTTACTTCTGGTAGTTGATCTTAAAACCCCAAAACATATATAGTATGGATCAGTCTGCCACTTGGCTGGAGGGTTTACCAATCAACAGAATAAAAGCTTTCCAGGAACTAAACCAGGGCCAGGAGTTGACCAATAATCTGCGGGAGA...

CDS

Download CDS FASTA

1011 bp · TkA04G094040|TK1151|CDS

ATGGATCAGTCTGCCACTTGGCTGGAGGGTTTACCAATCAACAGAATAAAAGCTTTCCAGGAACTAAACCAGGGCCAGGAGTTGACCAATAATCTGCGGGAGATGCTTCAGTGGCCGAGAAAGATAAAGTGTGATCCGGAATACGAAGATGGCCTCGTGATGCAAGTTGCCGCCATGTTTAAGAATACACTCTCGATCTTGGACTCATGCACTTCCGACCAGCATCTTCAGATGCCGGCAGCTGATCTGTGTTTAACATA...

Protein

Download Protein FASTA

336 aa · TkA04G094040|TK1151|PROTEIN

MDQSATWLEGLPINRIKAFQELNQGQELTNNLREMLQWPRKIKCDPEYEDGLVMQVAAMFKNTLSILDSCTSDQHLQMPAADLCLTYSSEGPISENFGESEGSITPANRKKGVYKKRNNSWKSSVVTSTLVDDGHAWRKYGQKHINNANYQRSYYRCTYKFDQGCLAAKQVQMIEDKPPKYKITYIGNHTCKNLQRSPEIILDSPTSRDTSILLNFETKGLVAKTEVGTYFPYMKDEVKEGYPSHGNLRHDRYSSSSDLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G094040`
TK1151 ID	TkA04G094040
OH-1004 ID	LXL04_035948
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G094040

Location Chr04:24466435-24468230 (-)

Description Similar to WRKY70: Probable WRKY transcription factor 70

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46400`	Transcription factor involved in the regulation of osmotic stress responses and stomatal movement.	EDS1 contributes to nonhost resistance of Arabidopsis thaliana against Erwinia amylovora.2012 · DOI: 10.1094/mpmi-05-11-0111 Arabidopsis WRKY46 coordinates with WRKY70 and WRKY53 in basal resistance against pathogen Pseudomonas syringae.2012 · DOI: 10.1016/j.plantsci.2011.12.003 Transcription factor WRKY46 regulates osmotic stress responses and stomatal movement independently in Arabidopsis.2014 · DOI: 10.1111/tpj.12538 Arabidopsis WRKY46, WRKY54, and WRKY70 Transcription Factors Are Involved in Brassinosteroid-Regulated Plant Growth and Drought Responses.2017 · DOI: 10.1105/tpc.17.00364
`At1g66600`	Transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0322900`	Transcriptional activator involved in defense responses against pathogens.	Rice WRKY45 plays a crucial role in benzothiadiazole-inducible blast resistance.2007 · DOI: 10.1105/tpc.106.046250 A pair of allelic WRKY genes play opposite roles in rice-bacteria interactions.2009 · DOI: 10.1104/pp.109.145623 Abscisic acid interacts antagonistically with salicylic acid signaling pathway in rice-Magnaporthe grisea interaction.2010 · DOI: 10.1094/mpmi-23-6-0791 OsWRKY45 alleles play different roles in abscisic acid signalling and salt stress tolerance but similar roles in drought and cold tolerance in rice.2011 · DOI: 10.1093/jxb/err144 Rice WRKY45 plays important roles in fungal and bacterial disease resistance.2012 · DOI: 10.1111/j.1364-3703.2011.00732.x
`UniProt: B8AWM1`	Transcriptional activator involved in defense responses against pathogens.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035948 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0002215 defense response to nematode Biological Process

GO:0002229 defense response to oomycetes Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009624 response to nematode Biological Process

GO:0009625 response to insect Biological Process

GO:0009682 induced systemic resistance Biological Process

KEGG gene cross-reference

ath:AT1G66600

ath:AT3G56400

dosa:Os05g0322900

osa:4338413

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.929

Rank 1 · TkA04G094040 · TK1151

Cytoplasm0.204

Rank 2 · TkA04G094040 · TK1151

Mitochondrion0.023

Rank 3 · TkA04G094040 · TK1151

Cell membrane0.022

Rank 4 · TkA04G094040 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA04G094040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106WRKY132-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G094040	`PF03106`	WRKY	132	192	1.4e-22	80.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKD9`	Arabidopsis thaliana	sp\|Q9SKD9\|WRK46_ARATH Probable WRKY transcription factor 46	32.200%	Swiss-Prot	Medium
`Q9C6H5`	Arabidopsis thaliana	sp\|Q9C6H5\|WRK63_ARATH Probable WRKY transcription factor 63	62.900%	Swiss-Prot	Low
`Q5W6D6`	Oryza sativa subsp. japonica	sp\|Q5W6D6\|WR451_ORYSJ Transcription factor WRKY45-1	31.900%	Swiss-Prot	Medium
`B8AWM1`	Oryza sativa subsp. indica	sp\|B8AWM1\|WK452_ORYSI Transcription factor WRKY45-2	51.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card