TkA04G086370 | RubberDandelionOmics

Gene overview

TkA04G086370

Reference: TK1151 Chr: Chr04 Coordinates: 22610010-22613695 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2238 bp · TkA04G086370|TK1151|cDNA

TGATTGGTTTGACTACTGAAACACTCTTCCCTTTTCTTTTCTCTTTCTCTCTCTTTAAAAACACAAAAACAAATACACATCTGCTTCCTAAATGCACAGTACTACTGCTCTTTAATATTTTCCCCAAACTTTTCCTCTCTTCAAAAATCTCTTATTTGTTTTAGTTTGACTCCTTTAAAACATTTCTAGGGTTTGTTCTTCACAAATCTGTCAACAGATTATAACAAATCTCGCAAACAAGGTTTGTGGGTTTTTTTCAC...

CDS

Download CDS FASTA

1653 bp · TkA04G086370|TK1151|CDS

ATGGGGTGTTTAACAGTACTAAAAGGCAAGAAAAAGAAATCAAACCCAAACATTCACGTAAAACGAATCAACCCACAAGACCCGACCCCAACTACATTACCCGAACCGCTAACCCGAACCCTACAGTCCGCACCACCAAGCTTCCGGAACCGGGTCAAACCGGTCCAGCCCAACAACACCAACCGTGAACGAGCCCTATCAGCTCCTTCAACCTTGGATGCGGCCGATCAAGACGCACTCTCATCAGCCGAATACGAAGA...

Protein

Download Protein FASTA

550 aa · TkA04G086370|TK1151|PROTEIN

MGCLTVLKGKKKKSNPNIHVKRINPQDPTPTTLPEPLTRTLQSAPPSFRNRVKPVQPNNTNRERALSAPSTLDAADQDALSSAEYEEHEESKTRGGVAGGLPPVPQPLPLPAPHTAIFKPMGSFKGGGGGSGLLPPLSASGPLPLPPSGTNHLPPMIPAPLPSSGPLKNFSFEEIAAACHNFSPERCVSEGLSSVMYRASFGEDTSSLKNLQATVTSLHPSSQGLKEFVSEVHTLASLQHPYLCKLIGFHAREGSDRRML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G086370`
TK1151 ID	TkA04G086370
OH-1004 ID	LXL04_035966
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 96.154 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G086370

Location Chr04:22610010-22613695 (-)

Description Similar to PIX7: Probable serine/threonine-protein kinase PIX7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15080`	Involved in chitin-triggered immune signaling and is required for reactive oxygen species (ROS) production.	Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315
`At3g28690`	Involved in chitin-triggered immune signaling and is required for reactive oxygen species (ROS) production.	Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315
`At3g01300`	Involved in chitin-triggered immune signaling and is required for reactive oxygen species (ROS) production.	Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856 Receptor-like cytoplasmic kinases PBL34/35/36 are required for CLE peptide-mediated signaling to maintain shoot apical meristem and root apical meristem homeostasis in Arabidopsis.2022 · DOI: 10.1093/plcell/koab315
`At1g14370`	Involved in disease resistance signaling.	Receptor-like cytoplasmic kinases integrate signaling from multiple plant immune receptors and are targeted by a Pseudomonas syringae effector.2010 · DOI: 10.1016/j.chom.2010.03.007 xopAC-triggered immunity against Xanthomonas depends on Arabidopsis receptor-like cytoplasmic kinase genes PBL2 and RIPK.2013 · DOI: 10.1371/journal.pone.0073469 The Decoy Substrate of a Pathogen Effector and a Pseudokinase Specify Pathogen-Induced Modified-Self Recognition and Immunity in Plants.2015 · DOI: 10.1016/j.chom.2015.08.004 Ligand-triggered allosteric ADP release primes a plant NLR complex.2019 · DOI: 10.1126/science.aav5868
`At2g07180`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035966 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010088 phloem development Biological Process

GO:0010492 maintenance of shoot apical meristem identity Biological Process

GO:0031663 lipopolysaccharide-mediated signaling pathway Biological Process

GO:1901653 cellular response to peptide Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G69790

ath:AT3G01300

ath:AT3G28690

ath:AT5G02290

ath:AT5G15080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.634

Rank 1 · TkA04G086370 · TK1151

Nucleus0.279

Rank 2 · TkA04G086370 · TK1151

Cytoplasm0.255

Rank 3 · TkA04G086370 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA04G086370 · TK1151

Plastid0.023

Rank 5 · TkA04G086370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr198-457 aa

PF00069Pkinase223-456 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G086370	`PF07714`	PK_Tyr_Ser-Thr	198	457	2.6e-24	86.7
TkA04G086370	`PF00069`	Pkinase	223	456	2.5e-22	80.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFP7`	Arabidopsis thaliana	sp\|Q9LFP7\|PBL34_ARATH Serine/threonine-protein kinase PBL34	38.200%	Swiss-Prot	Medium
`F4J0D2`	Arabidopsis thaliana	sp\|F4J0D2\|PBL36_ARATH Serine/threonine-protein kinase PBL36	38.200%	Swiss-Prot	Medium
`Q9SRH7`	Arabidopsis thaliana	sp\|Q9SRH7\|PBL35_ARATH Serine/threonine-protein kinase PBL35	38.800%	Swiss-Prot	Medium
`O49839`	Arabidopsis thaliana	sp\|O49839\|PBL2_ARATH Probable serine/threonine-protein kinase PBL2	37.100%	Swiss-Prot	Medium
`Q8H1E3`	Arabidopsis thaliana	sp\|Q8H1E3\|PBL17_ARATH Probable serine/threonine-protein kinase PBL17	35.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card