TkA04G085020 | RubberDandelionOmics

Gene overview

TkA04G085020

Reference: TK1151 Chr: Chr04 Coordinates: 22284571-22289669 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3571 bp · TkA04G085020|TK1151|cDNA

AAGAGAAACTATCAACCCACCACCGAGTCGTCTGCATTTCTCTCTGTATTTTTCATTCGCATTCATTTCCACACCCCCACTCATCTCCCTCACCACTTTCTCTCTCTAGAAATTTTCTTTAGGGGTGCAAACATTCGAAGAATTTGCATTGTGTGTAATTTTTTCAAGATAGTGTGGTATACAAACATAAAATCGTTATGATTGGGAGGAGATTCTGCTGAGCTGATTTTTGAATTAAGAAGAAATGCCATTCAGCAGAT...

CDS

Download CDS FASTA

2577 bp · TkA04G085020|TK1151|CDS

ATGCAAAATGGTGCAAGTGAACCCTCACGTCATGTGAAATTAAAAAAAAGAGAAATTAAATTTCCATTCGACACTGAAACCGGAAAAGGGTACATGGAGTCTTTATTAAGTTCTCCACCTGAGGATAAACTTGTCCACGAGGTCCCTATTCGACCAGGGCTTGAAATTCACGAGGGCAGTATCGTCAATTCCCCCAGTCAAAATGGAAGCCCATTTGAATCTCCAAGTATTGATAAGTCAATGAACAACATGCCTGGATT...

Protein

Download Protein FASTA

858 aa · TkA04G085020|TK1151|PROTEIN

MQNGASEPSRHVKLKKREIKFPFDTETGKGYMESLLSSPPEDKLVHEVPIRPGLEIHEGSIVNSPSQNGSPFESPSIDKSMNNMPGLMIPDLPENDSGVSSGIEEEEVEEKHMSDDRNHKADDVIADGYELDDVVSEGENYVDALATMESEIETETEVRGNSDPSVEQIQSHFSDYQSDNETESGSIKKKTENFSYSDSSTTSTDNTPRSATFASTEIPFRPRILTSQVSDEGAVLEESESGSKEQDLSEMSMSSSNRVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G085020`
TK1151 ID	TkA04G085020
OH-1004 ID	LXL04_036003
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 79.518 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G085020

Location Chr04:22284571-22289669 (-)

Description Similar to SCAR2: Protein SCAR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38440`	Involved in regulation of actin and microtubule organization.	DISTORTED3/SCAR2 is a putative arabidopsis WAVE complex subunit that activates the Arp2/3 complex and is required for epidermal morphogenesis.2005 · DOI: 10.1105/tpc.104.027987 IRREGULAR TRICHOME BRANCH1 in Arabidopsis encodes a plant homolog of the actin-related protein2/3 complex activator Scar/WAVE that regulates actin and microtubule organization.2005 · DOI: 10.1105/tpc.104.028670
`At5g01730`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q84TX2`	Involved in regulation of actin and microtubule organization.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036003 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010090 trichome morphogenesis Biological Process

GO:0010091 trichome branching Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0045010 actin nucleation Biological Process

GO:0051127 positive regulation of actin nucleation Biological Process

GO:0098609 cell-cell adhesion Biological Process

GO:2000601 positive regulation of Arp2/3 complex-mediated actin nucleation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010287 plastoglobule Cellular Component

GO:0031209 SCAR complex Cellular Component

KEGG gene cross-reference

ath:AT2G38440

ath:AT5G01730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.618

Rank 1 · TkA04G085020 · TK1151

Nucleus0.197

Rank 2 · TkA04G085020 · TK1151

Golgi apparatus0.150

Rank 3 · TkA04G085020 · TK1151

Cell membrane0.145

Rank 4 · TkA04G085020 · TK1151

Endoplasmic reticulum0.070

Rank 5 · TkA04G085020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15834THEG4249-307 aa

PF15834THEG4521-597 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G085020	`PF15834`	THEG4	249	307	5.4	7.7
TkA04G085020	`PF15834`	THEG4	521	597	5.4	7.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5XPJ9`	Arabidopsis thaliana	sp\|Q5XPJ9\|SCAR2_ARATH Protein SCAR2	43.800%	Swiss-Prot	Low
`Q5XPJ6`	Arabidopsis thaliana	sp\|Q5XPJ6\|SCAR4_ARATH Protein SCAR4	61.300%	Swiss-Prot	Low
`Q84TX2`	Oryza sativa subsp. japonica	sp\|Q84TX2\|SCRL1_ORYSJ SCAR-like protein 1	40.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card