TkA04G084270 | RubberDandelionOmics

Gene overview

TkA04G084270

Reference: TK1151 Chr: Chr04 Coordinates: 22080177-22081109 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

751 bp · TkA04G084270|TK1151|cDNA

GTCATCAACAAATCCCGCGGAGGCCGAAATGGCACAACAATCATCGTCAAAGCCACCAAACATACCCGATGTAGAGAATCAAAACCGGAACCACAACGAGAACCAGAATCAAAATCAAAATCACACAACGGGGTACATAGCCATCCTTCCAAGATGGATGCATAATCAAGAGATAGCAAGAAAAGGATTTTTAGCATTACGATGCTCCGGTTTGGTTTTTTCTATTCTTGCTAACTTTATCATGCCCACGAGCAAAACTG...

CDS

Download CDS FASTA

615 bp · TkA04G084270|TK1151|CDS

ATGGCACAACAATCATCGTCAAAGCCACCAAACATACCCGATGTAGAGAATCAAAACCGGAACCACAACGAGAACCAGAATCAAAATCAAAATCACACAACGGGGTACATAGCCATCCTTCCAAGATGGATGCATAATCAAGAGATAGCAAGAAAAGGATTTTTAGCATTACGATGCTCCGGTTTGGTTTTTTCTATTCTTGCTAACTTTATCATGCCCACGAGCAAAACTGATGATTGGTTTGATTGGAATGCTTTCGA...

Protein

Download Protein FASTA

204 aa · TkA04G084270|TK1151|PROTEIN

MAQQSSSKPPNIPDVENQNRNHNENQNQNQNHTTGYIAILPRWMHNQEIARKGFLALRCSGLVFSILANFIMPTSKTDDWFDWNAFDQYEELRYGFVITTLSLIYTFCQVWRECHVFSTGSWFIQNLALIDFVCDQIMAYLLISSASALVPLTTRMRKEGANNTFIGTLAVSISMEFFAFFVLGLSAIVSGYKLVKQIDASVAS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G084270`
TK1151 ID	TkA04G084270
OH-1004 ID	LXL04_036014
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.400
Protein coverage (%)	TK1151 100.000 / OH-1004 95.575 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G084270

Location Chr04:22080177-22081109 (+)

Description Similar to Os05g0344400: CASP-like protein 4B4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0344400`	CASP-like protein 4B4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036014 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

aly:9315816

ath:AT2G38480

dosa:Os03g0817100

dosa:Os05g0344400

sbi:8084021

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.782

Rank 1 · TkA04G084270 · TK1151

Endoplasmic reticulum0.116

Rank 2 · TkA04G084270 · TK1151

Cytoplasm0.087

Rank 3 · TkA04G084270 · TK1151

Lysosome / Vacuole0.064

Rank 4 · TkA04G084270 · TK1151

Nucleus0.044

Rank 5 · TkA04G084270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04535CASP_dom54-182 aa

PF01284MARVEL57-188 aa

PF04535CASP_dom181-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G084270	`PF04535`	CASP_dom	54	182	3.3e-19	69.8
TkA04G084270	`PF01284`	MARVEL	57	188	0.0093	16.7
TkA04G084270	`PF04535`	CASP_dom	181	198	3.3e-19	69.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5W6M3`	Oryza sativa subsp. japonica	sp\|Q5W6M3\|CSPLG_ORYSJ CASP-like protein 4B4	46.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card