TkA04G083790 | RubberDandelionOmics

Gene overview

TkA04G083790

Reference: TK1151 Chr: Chr04 Coordinates: 21930323-21932639 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1818 bp · TkA04G083790|TK1151|cDNA

TGATAATAGGCAAAATGACTAATATATGCCTTATATAATTTCTTAAATACTCAAGTACTATAGTGGAACCATAAATAGATTGAGTTCTATCCTTCTTATTTCTCTTCCCCACCCTTTTCCATAGAACTAAAGTCACTTTATATACCTTACACTACTCTCCCTCTCTCTCTCACTCTTTGTGTGTTTGCTTTCGTGAGGCTCTAGAGAGATGGCTAAGAAGCACTACTCCATTGGACTATGGAACATGAAGACCAAGTTCC...

CDS

Download CDS FASTA

1383 bp · TkA04G083790|TK1151|CDS

ATGGCTAAGAAGCACTACTCCATTGGACTATGGAACATGAAGACCAAGTTCCATTGCAGCGTAGTCATGTTCTTGGTTGGAGGATTAGCAACTTTAATCTTTTACGGAAACAATAATCAAGATGCAATAAATAGCAACGCTGCGGTTATTCTTGTCCGTATGAATACGAGCATGCCTACTAATGAAAACAAAAGTGTGGATACAAATACAATTACAGATACAAATACAAATACAAGAGTGTTTGATCATCAGAGAAGGCT...

Protein

Download Protein FASTA

460 aa · TkA04G083790|TK1151|PROTEIN

MAKKHYSIGLWNMKTKFHCSVVMFLVGGLATLIFYGNNNQDAINSNAAVILVRMNTSMPTNENKSVDTNTITDTNTNTRVFDHQRRLKIAPPTLTDTCDLFCGRWIHDNKSHYPLYKEEECPYLNADLACLTYGRKDSKYQQWRWQPHGCDFPKFDGKAIVEKLKGKRLLFVGDSVNRNQWDSMMCMLHSSIPGKKKLNMGGLNRTLYSFRSIEYNISIDYYWAPMLVESNGDDPSNHRLDHRTIRINAIEKHARHWVDA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G083790`
TK1151 ID	TkA04G083790
OH-1004 ID	LXL04_036025
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 77.572 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G083790

Location Chr04:21930323-21932639 (+)

Description Similar to TBL34: Protein trichome birefringence-like 34

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38320`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g01620`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0817500`	Xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	Biochemical characterization of rice xylan O-acetyltransferases.2018 · DOI: 10.1007/s00425-018-2882-1
`Os12g0106300`	Xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	Two Trichome Birefringence-Like Proteins Mediate Xylan Acetylation, Which Is Essential for Leaf Blight Resistance in Rice.2017 · DOI: 10.1104/pp.16.01618
`Os11g0107000`	Xylan acetyltransferase required for 2-O- and 3-O-monoacetylation of xylosyl residues in xylan.	Two Trichome Birefringence-Like Proteins Mediate Xylan Acetylation, Which Is Essential for Leaf Blight Resistance in Rice.2017 · DOI: 10.1104/pp.16.01618

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036025 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016413 O-acetyltransferase activity Molecular Function

GO:1990538 xylan O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G38320

dosa:Os03g0817500

osa:4351267

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.561

Rank 1 · TkA04G083790 · TK1151

Cell membrane0.113

Rank 2 · TkA04G083790 · TK1151

Extracellular0.099

Rank 3 · TkA04G083790 · TK1151

Endoplasmic reticulum0.071

Rank 4 · TkA04G083790 · TK1151

Cytoplasm0.034

Rank 5 · TkA04G083790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09084NMT146-78 aa

PF14416PMR5N97-151 aa

PF24536NXPE4_C145-223 aa

PF13839PC-Esterase153-445 aa

PF09084NMT1163-185 aa

PF09084NMT1334-375 aa

PF24536NXPE4_C382-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G083790	`PF09084`	NMT1	46	78	0.37	11.4
TkA04G083790	`PF14416`	PMR5N	97	151	1.3e-20	74.1
TkA04G083790	`PF24536`	NXPE4_C	145	223	0.0026	18.1
TkA04G083790	`PF13839`	PC-Esterase	153	445	3.5e-84	283.8
TkA04G083790	`PF09084`	NMT1	163	185	0.37	11.4
TkA04G083790	`PF09084`	NMT1	334	375	0.37	11.4
TkA04G083790	`PF24536`	NXPE4_C	382	403	0.0026	18.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80919`	Arabidopsis thaliana	sp\|O80919\|TBL34_ARATH Protein trichome birefringence-like 34	50.000%	Swiss-Prot	High
`Q8RXQ1`	Arabidopsis thaliana	sp\|Q8RXQ1\|TBL35_ARATH Protein trichome birefringence-like 35	46.100%	Swiss-Prot	Medium
`Q84TV3`	Oryza sativa subsp. japonica	sp\|Q84TV3\|XOATE_ORYSJ Xylan O-acetyltransferase 14	45.300%	Swiss-Prot	Medium
`Q2QYU2`	Oryza sativa subsp. japonica	sp\|Q2QYU2\|XOATD_ORYSJ Xylan O-acetyltransferase 13	46.600%	Swiss-Prot	Medium
`Q2RBL8`	Oryza sativa subsp. japonica	sp\|Q2RBL8\|XOATC_ORYSJ Xylan O-acetyltransferase 12	46.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card