TkA04G083110 | RubberDandelionOmics

Gene overview

TkA04G083110

Reference: TK1151 Chr: Chr04 Coordinates: 21750802-21751880 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

489 bp · TkA04G083110|TK1151|cDNA

ATGATGGTCTTACTATTTCTACGCAGAGTACACGATGTGGATATGAAGCGCGACTTTGCCTTTGTGGATTTCAGTGATTCAAGAGATGCTGATGATGCAAGATACAGTTTAAACGGTCGCGATGTTGATGGAAGCCGTATTGCTCCAAGAGGCGGCGGTGGCGGGCGTGACCGTGATGGCGGCGGCGGCGGCGGTGGCTCTCATCGGTGGCAAACTCAGGTAAACGAGCTACAATTCGATTTTTTGAGCTTAAAAGAAGA...

CDS

Download CDS FASTA

489 bp · TkA04G083110|TK1151|CDS

ATGATGGTCTTACTATTTCTACGCAGAGTACACGATGTGGATATGAAGCGCGACTTTGCCTTTGTGGATTTCAGTGATTCAAGAGATGCTGATGATGCAAGATACAGTTTAAACGGTCGCGATGTTGATGGAAGCCGTATTGCTCCAAGAGGCGGCGGTGGCGGGCGTGACCGTGATGGCGGCGGCGGCGGCGGTGGCTCTCATCGGTGGCAAACTCAGGTAAACGAGCTACAATTCGATTTTTTGAGCTTAAAAGAAGA...

Protein

Download Protein FASTA

162 aa · TkA04G083110|TK1151|PROTEIN

MMVLLFLRRVHDVDMKRDFAFVDFSDSRDADDARYSLNGRDVDGSRIAPRGGGGGRDRDGGGGGGGSHRWQTQVNELQFDFLSLKEEYFYPLMVGIGLLLLQQLTGINGVLFYSSDIFESAGIQSSKAATFGLGAIQVVATAVTTGLVDKSGRIVLLMAINR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G083110`
TK1151 ID	TkA04G083110
OH-1004 ID	LXL04_036032
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	76.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G083110

Location Chr04:21750802-21751880 (+)

Description Similar to At1g75220: Sugar transporter ERD6-like 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75220`	Sugar transporter.	No verified direct reference in this release
`At1g19450`	Sugar transporter.	No verified direct reference in this release
`At3g53500`	Probably involved in intron recognition and spliceosome assembly.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036032 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000245 spliceosomal complex assembly Biological Process

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0008380 RNA splicing Biological Process

GO:0008643 carbohydrate transport Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0042593 glucose homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G19450

ath:AT1G75220

ath:AT2G37340

ath:AT3G53500

ath:AT5G16150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.285

Rank 1 · TkA04G083110 · TK1151

Endoplasmic reticulum0.283

Rank 2 · TkA04G083110 · TK1151

Cell membrane0.180

Rank 3 · TkA04G083110 · TK1151

Cytoplasm0.128

Rank 4 · TkA04G083110 · TK1151

Golgi apparatus0.102

Rank 5 · TkA04G083110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076RRM_115-47 aa

PF00083Sugar_tr81-158 aa

PF14961BROMI97-156 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G083110	`PF00076`	RRM_1	15	47	3.4e-06	27.5
TkA04G083110	`PF00083`	Sugar_tr	81	158	6.9e-17	62.2
TkA04G083110	`PF14961`	BROMI	97	156	0.013	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FRL3`	Arabidopsis thaliana	sp\|Q9FRL3\|ERDL6_ARATH Sugar transporter ERD6-like 6	68.600%	Swiss-Prot	Medium
`Q93YP9`	Arabidopsis thaliana	sp\|Q93YP9\|ERDL4_ARATH Sugar transporter ERD6-like 4	69.600%	Swiss-Prot	Low
`Q9FYB7`	Arabidopsis thaliana	sp\|Q9FYB7\|RSZ32_ARATH Serine/arginine-rich splicing factor RS2Z32	72.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card