Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1194 bp · TkA04G082240|TK1151|cDNA
TGTGGATCGCCAAGGTTTTCTAGAGTCGCCAAGGGTGTCTTCTAAAAATTACTAAACGAAGTAACTTGCTCTGTGGAAGATGGAAGAAAGCGGAGAAGCAGCCGCCGCCACCCCAACAACAATCACAACGGCCGCCATCCCAACCGCTACCACCACCACCACCGCCTCCCCAACCACTACCACCACCTCCAAGCCCGCCAACGAAGTTGAAGCTACTGACGCCAGTAACATCAAGGTCAAAGTGTCTTATGGTTCCAACA...
813 bp · TkA04G082240|TK1151|CDS
ATGGAAGAAAGCGGAGAAGCAGCCGCCGCCACCCCAACAACAATCACAACGGCCGCCATCCCAACCGCTACCACCACCACCACCGCCTCCCCAACCACTACCACCACCTCCAAGCCCGCCAACGAAGTTGAAGCTACTGACGCCAGTAACATCAAGGTCAAAGTGTCTTATGGTTCCAACAATTTGGATGTCTTCATCCTTCCTCAATCCACTTTCGGTGAGCTGAAAAAGGAGATTGCAAAAGCAACTGGTTTAGAGCC...
Protein
Download Protein FASTA270 aa · TkA04G082240|TK1151|PROTEIN
MEESGEAAAATPTTITTAAIPTATTTTTASPTTTTTSKPANEVEATDASNIKVKVSYGSNNLDVFILPQSTFGELKKEIAKATGLEPEAQNLLFRGKEIDENEQLDLVGVKDNAKVIVTEVLHSPPKNEENLEKIEEVKEVIKEISKGMEAVSLVRKENDEFAEQVASLEAVVCSGTQVSDKDFLFLTEMLMRQLLKLDGIDAQGEGRLQRKSEVRRVQGLVDTLDSLKAKNSNPSSTNVPEPSTNNSNPSTNNVPEPST...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G082240 |
|---|---|
| TK1151 ID | TkA04G082240 |
| OH-1004 ID | LXL04_036043 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G082240 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:21543377-21546607 (+) | |||||||||
| Description | Similar to BAG4: BAG family molecular chaperone regulator 4 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006612 protein targeting to membrane Biological Process GO:0009409 response to cold Biological Process GO:0009651 response to salt stress Biological Process GO:0010119 regulation of stomatal movement Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0043268 positive regulation of potassium ion transport Biological Process GO:0050821 protein stabilization Biological Process GO:0071629 cytoplasm protein quality control by the ubiquitin-proteasome system Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G51780 ath:AT5G07220 ath:AT5G52060 ath:AT5G62100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF26986Cap_depo13-100 aaPF05316VAR136-63 aaPF11976Rad60-SLD50-114 aaPF00240ubiquitin51-118 aaPF21403OTU1_UBXL53-88 aaPF18396TBK1_ULD63-100 aaPF14560Ubiquitin_267-105 aaPF18037Ubiquitin_573-120 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G082240 | PF26986 | Cap_depo | 13 | 100 | 0.21 | 12.4 |
| TkA04G082240 | PF05316 | VAR1 | 36 | 63 | 0.035 | 14.9 |
| TkA04G082240 | PF11976 | Rad60-SLD | 50 | 114 | 5e-06 | 26.9 |
| TkA04G082240 | PF00240 | ubiquitin | 51 | 118 | 5.1e-11 | 42.9 |
| TkA04G082240 | PF21403 | OTU1_UBXL | 53 | 88 | 0.015 | 16.6 |
| TkA04G082240 | PF18396 | TBK1_ULD | 63 | 100 | 0.0014 | 19.3 |
| TkA04G082240 | PF14560 | Ubiquitin_2 | 67 | 105 | 0.14 | 13.4 |
| TkA04G082240 | PF18037 | Ubiquitin_5 | 73 | 120 | 0.0005 | 21.0 |
| TkA04G082240 | PF09657 | Cas_Csx8 | 74 | 157 | 0.098 | 12.4 |
| TkA04G082240 | PF05316 | VAR1 | 120 | 244 | 0.035 | 14.9 |
| TkA04G082240 | PF00240 | ubiquitin | 133 | 145 | 5.1e-11 | 42.9 |
| TkA04G082240 | PF27944 | CEP162_coil_mid | 135 | 171 | 0.12 | 13.1 |
| TkA04G082240 | PF02179 | BAG | 139 | 147 | 3.6e-18 | 66.5 |
| TkA04G082240 | PF02179 | BAG | 159 | 228 | 3.6e-18 | 66.5 |
| TkA04G082240 | PF26986 | Cap_depo | 195 | 237 | 0.21 | 12.4 |
| TkA04G082240 | PF07589 | PEP_exosort_dom | 240 | 245 | 1.2 | 10.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.